KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2070Help
Entry
GbCGDNIH1_2070    CDS       T00392                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GbCGDNIH1_2070
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GbCGDNIH1_2070
   00640 Propanoate metabolism
    GbCGDNIH1_2070
   00660 C5-Branched dibasic acid metabolism
    GbCGDNIH1_2070
Enzymes [BR:gbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GbCGDNIH1_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2317015..2318211)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKELLKEFGIPVLEGHVAWTPDEAREAARRLPGPRYVVKAQIHAGGRGAGHFL
HSQSGRGGVRLAASVEEAGEHAAAMLGQILVTKQTGAAGRRVHRVYIEAGCEIERELYLS
LLVDRDTSRVTIVASAEGGMDIEEVAASRPERIVRVTVDPAMGLSEFHARRIAFRLGLSG
MQLASFGRMVKALYKAYIALDCAVVEINPLVVTKGGDMLALDAKVIFDDNALYRHPELER
LRDPAEEDPKELEAARHKLSYIALDGTIGCMVNGAGLAMATMDIIRLYGAKPANFLDVGG
GATKERVAAAFKIILADPNVEGILINIFGGIMRCDVIAEGVVAAAREVSLSVPLVVRLEG
TNVEQGRAILNQSGLSIVAADDLDDAARKIVAAVAEAG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattcatgaataccaggccaaggaactcctgaaggagtttggcatcccggtgctg
gaaggccatgtggcctggaccccggacgaggcgagagaagcagcacggcggctgccgggg
ccacgctatgtggtcaaggcacagatccatgcgggcgggcgcggagcggggcattttctg
cacagccagtccggccgcggcggtgtgcgcctggcggcttcggtcgaggaagctggcgag
catgcggcagcgatgctcggccagattctggtgacgaagcagaccggcgctgccgggcga
cgcgtccatcgtgtctatatcgaggccggttgcgagatcgagcgggagttgtacctctcc
ctgctggtcgaccgcgatacatcccgcgtcaccattgtcgcttcagccgagggcggcatg
gatatcgaggaggtcgccgcctcgcgaccggagcggatcgtgcgggtaacagttgatccc
gcgatgggtctgtccgagtttcatgcaaggcggattgcgttccggctgggcttgagcggg
atgcaactggcctcgttcggccggatggtgaaggcgctttacaaggcctatatcgcgctc
gactgcgcagtggtggaaatcaacccgctggtcgtcaccaaaggcggggacatgctggcg
ttggatgccaaagtgattttcgacgacaacgccctttatcgccacccggagctggaacgc
ctgcgcgatccggcagaggaagacccgaaagagctggaagccgcacgccacaagctgagc
tacatcgcgctggatggcacgatcggctgcatggtcaatggcgccggtctggccatggcg
acgatggatatcatccggctgtacggcgcaaagcccgccaatttccttgatgtcggcggc
ggtgcgaccaaggagcgtgtggcggcggctttcaagatcattctggccgatccgaatgtc
gaaggcatcctgatcaatattttcggcggtatcatgcgttgcgacgtgattgcggaaggc
gtggtcgccgcggcgcgggaggtcagcctgtccgtaccgctggtggtgcgactggaaggc
accaatgtcgagcagggaagggcgatcctgaaccagtccggcctgtcgattgtggcggcg
gatgatctggacgatgccgcacgcaagattgtcgcggctgtggcggaggcaggctga

DBGET integrated database retrieval system