KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2079Help
Entry
GbCGDNIH1_2079    CDS       T00392                                 

Definition
succinate dehydrogenase membrane anchor subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GbCGDNIH1_2079
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GbCGDNIH1_2079
   00650 Butanoate metabolism
    GbCGDNIH1_2079
  Energy metabolism
   00190 Oxidative phosphorylation
    GbCGDNIH1_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2326718..2327116)
Genome map
AA seq 132 aa AA seqDB search
MAQSSPRIRVMRSHLGRARGLGSAKHGLTHWWAERVTSVALVPLTLWFIFAALHLTGHSR
AEVAQWVGHPVHAVLLLSLVFATFHHVQLGLQVIIEDYVHTESVKIASLLATKAVCFLLG
LACAVSILKMTL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcatctccccgtattcgcgtcatgcgcagccatctgggccgtgcgcgtggc
cttggttccgcgaaacacggcctgacccactggtgggcggaacgtgtgacttcggttgca
ctggtgccgctgaccctctggttcatcttcgccgcgctgcacctgaccggtcatagccgg
gccgaggtcgcgcaatgggttggtcatccggtccatgccgtgctgctgctgagcctggtg
ttcgccactttccaccatgtccagctcggtctacaggtcatcatcgaggattacgtacat
acggaatccgtgaaaatcgccagcctgctcgcgacaaaggccgtctgcttcctgctcggt
ctggcctgtgcggtttccatcctgaagatgacgctctga

DBGET integrated database retrieval system