KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2253Help
Entry
GbCGDNIH1_2253    CDS       T00392                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GbCGDNIH1_2253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GbCGDNIH1_2253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GbCGDNIH1_2253
Enzymes [BR:gbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GbCGDNIH1_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2501880..2503328
Genome map
AA seq 482 aa AA seqDB search
MRYISTRGEAPIRDFSGVLLAGLAEDGGLYMPESWPQFSHDEWRAMRGLPYPDLAARIIQ
PFVGDCIPAETLLTLCRDAYAGFTHPAIVPLVQLDHDVYTQELFHGPTLAFKDMAMQLLG
RLFDYVLSQSDRRITIVGATSGDTGSAAIEAVRGRDRVDIVILHPEGRTSTVQRRQMTTA
IAPNIGNVAVRGTFDDCQDLVKAMFADTPFRQEMSLSAVNSINWARIAAQIPYYVYAALQ
LGAPDRAVAFSVPTGNFGNVLAAYAAHRMGLPVGKLVVASNRNDILYRFLSANDMSARPV
EPSLSPSMDIQVSSNFERVLFELLDRDPAATAATIRAFRETGRMPVADATWQKARTLFQG
FRMDDTDTEAAIRALRQETGYLADPHSVIGIAAARSLRNAGSLSAAGPVIAMATAHPAKF
PDAMERATGERPALPPHLSDLYDREERFTVADNNLADIEALVRNIAHRNTSPASSPVTGV
PA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatctccacacggggcgaggccccgatccgtgacttctcaggcgttctgctc
gccgggcttgccgaggatggcgggttgtatatgccggaatcctggccgcagttttcccac
gatgagtggcgcgccatgcgtggcctgccctatccggatctggccgcacgcatcattcag
cctttcgtcggcgactgcatcccagccgaaactctgctgacgctgtgccgcgatgcctat
gcgggctttacccatccggccatcgtgccgctggtacagctcgatcacgatgtctatacg
caggaactgtttcacggcccgacccttgcattcaaggatatggccatgcagttgctgggg
cggctgttcgattacgtgctgagccagagcgaccgccgcatcaccattgtcggcgcgacc
tccggcgataccggctccgccgctattgaggccgtgcggggacgggaccgggtggatatc
gtcatcctccaccccgaaggccgcaccagcaccgtgcagcggcggcagatgaccaccgct
atcgccccgaatatcggcaatgtcgccgtgcgcggcacgttcgatgactgccaggatctg
gtcaaggcaatgttcgccgataccccattccggcaggaaatgagcctgtccgccgtcaac
tccatcaactgggcgcggatcgcggcgcagattccctattacgtctacgccgcccttcaa
ctcggcgcaccggaccgggcggtggcgttcagcgtgccgaccgggaatttcggcaatgtg
ctggccgcttatgccgcccatcgcatggggctgcccgtaggcaagctggttgttgcctcc
aaccgcaatgacattctctaccgcttcctgagcgcgaatgacatgtcggcacgcccggtc
gagccgagcctgtcgccgagcatggatattcaggtcagttccaatttcgaacgggtgctg
ttcgaattgctggatcgtgatcccgccgccaccgccgccacgattcgcgctttccgggaa
acaggccgcatgccggtggccgatgccacatggcagaaggcaagaactctgtttcagggc
ttccgcatggacgacacggacacggaggccgccattcgcgccttgcgacaggaaaccggc
tatctggccgatccgcacagcgtcatcggcattgcagcggcacggagcctgcgcaacgct
ggcagtctgtcggcagccggtcccgtcatcgccatggcgacggcccatccggccaaattc
cccgatgcgatggaacgcgccaccggtgagcgccccgccctgccgcctcatctgagcgat
ctgtacgatcgcgaggagcggttcaccgtcgccgataataatctggcggatatcgaggct
ctggtgcgcaatatcgcccaccgcaatacaagcccggcatcctcccccgtaaccggagtg
cctgcctga

DBGET integrated database retrieval system