KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2253Help
Entry
GbCGDNIH1_2253    CDS       T00392                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GbCGDNIH1_2253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GbCGDNIH1_2253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GbCGDNIH1_2253
Enzymes [BR:gbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GbCGDNIH1_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2501880..2503328
Genome map
AA seq 482 aa AA seqDB search
MRYISTRGEAPIRDFSGVLLAGLAEDGGLYMPESWPQFSHDEWRAMRGLPYPDLAARIIQ
PFVGDCIPAETLLTLCRDAYAGFTHPAIVPLVQLDHDVYTQELFHGPTLAFKDMAMQLLG
RLFDYVLSQSDRRITIVGATSGDTGSAAIEAVRGRDRVDIVILHPEGRTSTVQRRQMTTA
IAPNIGNVAVRGTFDDCQDLVKAMFADTPFRQEMSLSAVNSINWARIAAQIPYYVYAALQ
LGAPDRAVAFSVPTGNFGNVLAAYAAHRMGLPVGKLVVASNRNDILYRFLSANDMSARPV
EPSLSPSMDIQVSSNFERVLFELLDRDPAATAATIRAFRETGRMPVADATWQKARTLFQG
FRMDDTDTEAAIRALRQETGYLADPHSVIGIAAARSLRNAGSLSAAGPVIAMATAHPAKF
PDAMERATGERPALPPHLSDLYDREERFTVADNNLADIEALVRNIAHRNTSPASSPVTGV
PA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatctccacacggggcgaggccccgatccgtgacttctcaggcgttctgctc
gccgggcttgccgaggatggcgggttgtatatgccggaatcctggccgcagttttcccac
gatgagtggcgcgccatgcgtggcctgccctatccggatctggccgcacgcatcattcag
cctttcgtcggcgactgcatcccagccgaaactctgctgacgctgtgccgcgatgcctat
gcgggctttacccatccggccatcgtgccgctggtacagctcgatcacgatgtctatacg
caggaactgtttcacggcccgacccttgcattcaaggatatggccatgcagttgctgggg
cggctgttcgattacgtgctgagccagagcgaccgccgcatcaccattgtcggcgcgacc
tccggcgataccggctccgccgctattgaggccgtgcggggacgggaccgggtggatatc
gtcatcctccaccccgaaggccgcaccagcaccgtgcagcggcggcagatgaccaccgct
atcgccccgaatatcggcaatgtcgccgtgcgcggcacgttcgatgactgccaggatctg
gtcaaggcaatgttcgccgataccccattccggcaggaaatgagcctgtccgccgtcaac
tccatcaactgggcgcggatcgcggcgcagattccctattacgtctacgccgcccttcaa
ctcggcgcaccggaccgggcggtggcgttcagcgtgccgaccgggaatttcggcaatgtg
ctggccgcttatgccgcccatcgcatggggctgcccgtaggcaagctggttgttgcctcc
aaccgcaatgacattctctaccgcttcctgagcgcgaatgacatgtcggcacgcccggtc
gagccgagcctgtcgccgagcatggatattcaggtcagttccaatttcgaacgggtgctg
ttcgaattgctggatcgtgatcccgccgccaccgccgccacgattcgcgctttccgggaa
acaggccgcatgccggtggccgatgccacatggcagaaggcaagaactctgtttcagggc
ttccgcatggacgacacggacacggaggccgccattcgcgccttgcgacaggaaaccggc
tatctggccgatccgcacagcgtcatcggcattgcagcggcacggagcctgcgcaacgct
ggcagtctgtcggcagccggtcccgtcatcgccatggcgacggcccatccggccaaattc
cccgatgcgatggaacgcgccaccggtgagcgccccgccctgccgcctcatctgagcgat
ctgtacgatcgcgaggagcggttcaccgtcgccgataataatctggcggatatcgaggct
ctggtgcgcaatatcgcccaccgcaatacaagcccggcatcctcccccgtaaccggagtg
cctgcctga

DBGET integrated database retrieval system