KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2266Help
Entry
GbCGDNIH1_2266    CDS       T00392                                 

Definition
2-hydroxy-3-oxo-5-methylthiopent-2-enoate oxidase (EC:1.-.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GbCGDNIH1_2266
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GbCGDNIH1_2266
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GbCGDNIH1_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2515090..2515629
Genome map
AA seq 179 aa AA seqDB search
MSRLTIYADSTPDAPLLRTEDPERIAQELSSIGVRFERWSSAVTPSPDDDEATILAAYRP
YLNALMGETGAGTADVIRLRPDTPNLPALRQKFLSEHTHTEDEVRFFVHGSGNFILHVDD
RVYDAHCTQGDLISVPTGIKHWFDAGETPFVTALRVFTDTTGWVAHYTGDPIADHFPAA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctgaccatttacgcagactccacaccggatgcgccgctgctccggaccgaa
gatccggaacggatcgcacaggaattgagtagcatcggtgttcgcttcgaacgctggagc
agcgctgttaccccgtctccggatgatgacgaagccaccattctggccgcatatcgccct
tacctgaatgcgttgatgggcgaaacgggtgccggcactgcggatgtgatccgcctgcgg
cccgatacaccgaacctgcccgcgttgcggcagaaattcctgtccgagcatacccatacc
gaggatgaagtccgtttcttcgttcatggcagtggcaatttcattctccatgtcgatgac
agggtttatgatgcacactgcacacagggggatctgatttccgttcccaccggcatcaaa
cactggttcgatgcgggcgaaacaccctttgtcaccgccctgcgcgtgttcaccgatacc
acaggttgggtggcccattacacgggtgatccgattgctgaccatttcccggctgcatga

DBGET integrated database retrieval system