KEGG   Granulibacter bethesdensis: GbCGDNIH1_2266Help
Entry
GbCGDNIH1_2266    CDS       T00392                                 

Definition
2-hydroxy-3-oxo-5-methylthiopent-2-enoate oxidase (EC:1.-.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gbe  Granulibacter bethesdensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gbe00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2515090..2515629
Genome map
AA seq 179 aa AA seqDB search
MSRLTIYADSTPDAPLLRTEDPERIAQELSSIGVRFERWSSAVTPSPDDDEATILAAYRP
YLNALMGETGAGTADVIRLRPDTPNLPALRQKFLSEHTHTEDEVRFFVHGSGNFILHVDD
RVYDAHCTQGDLISVPTGIKHWFDAGETPFVTALRVFTDTTGWVAHYTGDPIADHFPAA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctgaccatttacgcagactccacaccggatgcgccgctgctccggaccgaa
gatccggaacggatcgcacaggaattgagtagcatcggtgttcgcttcgaacgctggagc
agcgctgttaccccgtctccggatgatgacgaagccaccattctggccgcatatcgccct
tacctgaatgcgttgatgggcgaaacgggtgccggcactgcggatgtgatccgcctgcgg
cccgatacaccgaacctgcccgcgttgcggcagaaattcctgtccgagcatacccatacc
gaggatgaagtccgtttcttcgttcatggcagtggcaatttcattctccatgtcgatgac
agggtttatgatgcacactgcacacagggggatctgatttccgttcccaccggcatcaaa
cactggttcgatgcgggcgaaacaccctttgtcaccgccctgcgcgtgttcaccgatacc
acaggttgggtggcccattacacgggtgatccgattgctgaccatttcccggctgcatga

DBGET integrated database retrieval system