KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2371Help
Entry
GbCGDNIH1_2371    CDS       T00392                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GbCGDNIH1_2371
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH1_2371
   00630 Glyoxylate and dicarboxylate metabolism
    GbCGDNIH1_2371
Enzymes [BR:gbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GbCGDNIH1_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2635928..2638144
Genome map
AA seq 738 aa AA seqDB search
MNAITLATRSLLPSGLQIAPVLHRFVEEEAMPGTGITAEAFWAALAVALRTLGPANAALL
NQRNTLQAEINQWHRVHTLPQSGVGAALAAQSDAYRAFLHEIGYLLPPPAAFQVDTAQVD
DEIAHIAGPQLVVPVNNARYALNAANARWGSLYDALYGTDAVGRQQSATRGYDEARGAEV
IRHGRAVLDIAAPLAEGSHADAMLYAVHNGKLRIALANGHVTGLRDESGFCGYTGAPDAP
SRILLVRHGLHLEILFDRDHRVGRNDKAGIADLILESALSTIMDAEDSVAAVDAEDKVEV
YRNWLGLMRGDLTVRFEKNGAAVERSLHQDRVYTTPDGSGSLTLPGRSLLLIRNVGHHMM
TDAVMLDGAEVPETILDAFITSLIGLHDLRGRPGRHITNSRTGSLYIVKPKMHGPDEVAW
AARLFSTVEDALTLPRNTIKMGIMDEERRTSVNLAHCIEAVRSRVFFINTGFLDRTGDEI
HTSMEAGPMLRKNDMKQTAWFTAYENGNVDSGLACGLPGHAQIGKGMWAAPDNMAAMLAE
KIDHQRAGASTAWVPSPTAATLHALHYHQIDVAQRQATIAREGARTSLHALLTLPLLEEA
GKLTAQEIRDELDNNVQGILGYVVRWVDQGIGCSKVPNIYNVGLMEDRATLRISAQHIAN
WLRHGVVSREQVEETLRRMAVVVDGQNAGDPAYRPIAPAFDGPAFLAACDLIFKGTEQPN
GYTEFVLHRRRREAKART
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcacccttgccacccgatcccttctgccctccggccttcagattgcgccg
gttctgcatcgatttgtggaagaggaagcgatgcccggcactggcatcacagccgaggca
ttctgggccgcactcgccgtcgccctgcgcacattggggcccgcaaacgctgccctgctc
aatcagcggaatacgttgcaggccgagatcaaccagtggcaccgcgtccatacgctgccg
caatccggcgtcggtgcggcactggcggcacaatccgacgcctaccgcgcgtttctgcat
gaaatcggctatctgctgccgccaccggccgcgtttcaggtcgataccgcacaggtggat
gatgagatcgcccatatcgccgggccacagctcgtcgttccggtcaacaatgcacgctat
gctctgaatgccgccaatgcgcgctggggcagcctgtatgatgcgttatacggcacagat
gccgtcggacgtcagcaaagcgcgacgcggggctatgatgaggcacgcggagccgaggtt
ataagacatggccgcgcggtgctggacatcgcagcccctctggccgaaggcagccatgcc
gatgccatgctctatgcggtacacaatggtaagttacggattgcgctggccaacggacat
gtgaccggactacgcgatgagtccggattctgcggatataccggcgcgcctgatgcaccc
agccgtattctgctggtcaggcacgggctgcatctggaaatcctgttcgatcgcgaccat
cgcgtcggtcgcaatgataaagccggtattgccgatctgattcttgaatcagccctgtcc
accatcatggatgcggaagactccgtcgccgcggtcgatgcggaggacaaggtcgaggtc
tatcgcaactggctgggtctgatgcgcggcgacctgacggtcaggttcgagaaaaacggc
gccgccgtcgaacgtagcctgcatcaggatcgggtttacactacgcctgatggcagcggc
agcctgacgctgcccggtcgatccctgctgctgatccgcaatgtcggtcatcacatgatg
accgatgcggttatgctggacggggcagaggtgccggagaccattctggatgcattcatc
accagcctgatcggcctgcatgatctgcgcgggcggcccggcaggcacatcaccaacagc
cgaaccggcagcctgtatatcgtgaagccgaaaatgcacgggccggatgaggtagcctgg
gcagcgcggctgttcagtacggtggaagatgcgctgactctgccccgcaacaccatcaag
atgggcatcatggatgaggagcgccggaccagcgtcaatctggcgcattgtatcgaagca
gtccgcagccgggtgtttttcatcaataccggctttctggaccgcaccggagacgaaatc
cacaccagcatggaagccggtcccatgctgcgtaagaacgacatgaaacagactgcgtgg
ttcacggcctatgaaaacggcaacgtggatagtgggctggcctgtggtctgcccggccat
gcccagatcggcaaaggcatgtgggcggcacccgacaacatggcggcgatgctggccgag
aaaatcgaccatcagcgcgccggggccagtacggcctgggttccttcccccacggcagcc
acgctgcacgcgctgcattatcatcagatcgacgtggcgcaacggcaggcgaccattgcc
agagaaggtgcccgcacctcactgcatgctctgctgaccctgccattgctggaggaggcg
gggaaactaaccgctcaggaaatcagggatgagctggacaataatgttcagggtattctg
ggctatgtcgtccgctgggtggatcaggggatcggctgctccaaagtaccgaacatctac
aatgtcggcttgatggaggaccgcgccacgctgcgcatttccgcacagcacatcgccaat
tggctgcgccatggtgtcgtgagccgggaacaggtcgaagaaacactgcgccgcatggcc
gtagtggtggatgggcagaatgcgggcgatcccgcctatcgacccatcgcaccagccttc
gatggacccgcctttctggcggcatgcgatctgatcttcaaaggcaccgagcagccaaat
ggctatacagagttcgtgctgcaccgccggcgtcgagaggccaaagcccggacctga

DBGET integrated database retrieval system