KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0751Help
Entry
GbCGDNIH2_0751    CDS       T03083                                 

Definition
Trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GbCGDNIH2_0751
Enzymes [BR:gbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GbCGDNIH2_0751
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GbCGDNIH2_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2592986..2596447
Genome map
AA seq 1153 aa AA seqDB search
MDASLCNLARQTSNLRKLPAAGSIIIFSCALSGLTTNLIGVHMSKNTALSPIEDPLWYKD
AIIYQLHVKSFFDGDNDGIGDFKGLLSKLDYIAELGVTAIWLLPFYPSPRRDDGYDIADY
RGVHKDYGSLADFRRFVAEAHARGLRVITELVVNHTSDQHPWFRKARESKPGSAARNFYV
WSDDDKKYSGTRIIFLDTEKSNWTWDETAKAYFWHRFYSHQPDLNFDNPRVLQEVLSVMR
FWLDIGVDGLRLDAVPYLVEREGTNNENLPETHDILKRIRAELDAHAPGRMLLAEANQWP
EDAQQYFGEGDECHMSFHFPLMPRMYMAIAREDRFPVTDIMRQTPEIPALCQWAVFLRNH
DELTLEMVTDSERDYLWSTYAADRRARINLGIRRRLAPLLEHDRRRIELMNGLLLSMPGT
PVIYYGDEIGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRANPAALVLPTIMDPVYGFQAV
NVEAQAADQHSLLNWMRRMLAVRRQFTAFGRGTLRFLYPENRKVLAYLREHEDSGNEQTI
LCICNLSRSAQAVELDISAFSGRVPVDMVGGSAFPPVGQLPYLLTLPPYGFFWFVLAQSE
HLPHWYTPPSESLPDYATVVIRSDISEVLEAQNRKILETESLPAYLPKRRWFGAKGERVK
AARFAYMARLGGHEGDPVLLGEVEVQLDSRTERYTLPLGIVWEDDISSPLVAQLALARVR
RGRRVGYLTDAFAVDSLTGALMTSLRRAANNHSSLSVDDGTIEFRPTPLLAELTLPPDPE
IRRLSAEQSNSSLILGETIVFKLIRRVSSGIHPEGEMTRVLTERGFANTAPLYGEMVRIG
PDGTPHTLALAQGFVRNQGDAWQWTLDFLSRAVEEYAVTGRSGTTESDLFGGYNVLASAI
GRRLAEMHAILTWPDDNPDFSPVAVDVHDLQGWADSAREQVRDAFRLLHGMTEFASNETA
DQVRALLAQEAEIVERLDTLATKGAGAIKTRIHGDFHLGQVLVVQDDAYLIDFEGEPARP
LEQRRAKGNGLRDVAGLLRSFDYAASSGGMSLTIAGAAQMTERRDHLLQQFRQSATRSFL
DAYLEVLRSADTPWVQPEGIEPLLTLFLIEKAAYEIRYEAANRPGWIGIPVAGLYHLVFG
ASPSSPATDEGHS
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgtccctatgcaatctggcgcgccagaccagcaacctaaggaagctgcctgcg
gcgggcagcattatcatattttcctgtgctttgagtggcctgacgaccaatttgattgga
gttcacatgagcaaaaacaccgcactgtcaccgattgaagatccgctctggtacaaagat
gcaatcatctaccagttgcacgttaaatcattcttcgatggggacaatgacggaattggc
gactttaaaggactgctttcaaaactcgactatattgccgagctcggggtcacggccata
tggctgctgcctttctatccttccccccggcgagatgacggatatgatattgccgattac
cggggtgttcataaagattacggatcactggcggatttccgccgctttgtagccgaagcc
catgcgcgcgggctgagggtgattacggagcttgtggtcaatcatacgtccgaccaacac
ccatggttcaggaaagcccgggaaagcaagcccggatcggcagcacgtaatttttatgtc
tggtctgatgacgacaaaaaatatagcggcaccagaattatctttctcgacacagagaaa
tccaactggacatgggatgaaacggccaaagcctatttctggcaccgcttctactcccat
cagcctgatctgaatttcgacaatccccgcgtcttgcaggaagttctgtcggtgatgcgg
ttctggctggatattggtgttgatggattgcgccttgatgccgtgccttatctggtggag
cgcgagggcaccaataatgaaaaccttcctgaaacgcacgatattctgaaacgcattcgc
gcagaactcgatgcgcatgcaccgggcagaatgctgctggcagaagccaatcaatggccg
gaagacgcgcagcaatatttcggcgagggcgatgaatgccatatgtcgtttcattttccg
ctgatgccccgcatgtatatggccattgcacgggaggaccgcttcccggtcaccgacatc
atgcggcagacacctgaaattccagctctctgtcagtgggcggtgtttctgcgcaaccat
gacgagttgacgctggaaatggtcacggatagcgaacgagactatctatggagcacgtac
gctgctgaccgcagggcgcgcatcaatctgggcattcgccgccgtctggcaccgctgctg
gaacatgaccgccgccgtatcgaattgatgaacgggttgctgctctccatgccgggaaca
ccggttatttattacggcgatgaaatcggcatgggcgacaatatccatctcggcgaccgt
gatggggtgcgcacgccgatgcaatggtccagcgaccgcaatggcggtttttcccgtgct
aatccggcagccctggttctgccgacgatcatggacccagtctatggatttcaggccgtc
aatgtggaagcgcaggcagcggaccagcattccctgctgaactggatgcgccgcatgttg
gcggtacgcaggcagttcacggctttcgggcgcggcacgctgcgtttcctgtatccggag
aaccgtaaagttctggcctatctgcgtgaacatgaggatagcggcaatgagcagaccatt
ctctgtatctgcaatctgtcccgctcggcgcaggcagtcgagctggacatcagcgccttc
agtggacgcgtcccggtggacatggtcggtggctctgcttttcccccggttgggcaattg
ccgtatctgttgacgctgcctccttatggtttcttctggttcgtgctggcccagagcgag
catctgccacattggtacacgcccccatccgaatccctgccggattatgcaacggtggtg
atccgttccgacatcagcgaggttctggaagcacagaaccgaaaaattctggaaactgaa
agcctccccgcctatctgccaaaacggcgctggttcggcgcgaaaggcgaaagggtcaaa
gccgcacgctttgcctacatggcgcgtctcggcggccacgagggtgatccggtgctgctg
ggtgaggtcgaagtccaactcgactcacgcaccgaacgttatacgcttccactcggcatc
gtgtgggaggatgatatcagcagcccgctggtcgcacagcttgccctggcccgtgtacga
cgtggacgaagggtgggctatcttaccgatgccttcgcggtggacagcctgacgggcgca
ctgatgacaagcctgcgccgtgctgccaataatcacagctcattgagcgtggatgatggc
acaatagaatttcgtccgaccccccttctggcggagcttactttgccgccggatccggaa
attcgccgtctttcagccgaacagtccaattcttcgctgattttgggagaaacgatcgtc
ttcaagctgatccgtcgtgtcagcagcggtatccatcccgaaggcgagatgacgcgggtg
ctgactgaacgcggctttgccaatacagcaccactttatggtgagatggtgcggatcggc
cccgatggcacaccgcatacgctggcgctggcacagggcttcgtgcgcaaccagggcgat
gcgtggcaatggacgctggatttcctcagccgggcggtggaggaatatgccgtcaccggt
cgcagtggcacaacggaaagtgacctgttcggcggttataatgtgctggcctccgctatc
ggccgtcgtcttgcggaaatgcatgcgatcctgacatggcccgatgacaatcctgatttc
agccctgttgccgtcgatgtccatgacttgcagggctgggccgacagtgcgcgggaacag
gtgcgcgacgccttccgcctgctacatggcatgacggagtttgcttccaacgaaactgcc
gatcaggtcagagctctgctagctcaggaggcggaaatagtagaacgcctcgatacactc
gccacaaagggagcaggcgcaataaagacccggattcacggggatttccatcttggacaa
gtgctggtcgtgcaggatgacgcctacctgatcgatttcgagggcgagcctgcccgtccg
ctggagcagcgacgcgccaaaggcaatggtttgcgagacgttgcgggtttgctgcgcagt
tttgactatgcggcctcctccggcggcatgtcgctgaccattgccggcgctgcacagatg
acggaacgacgggatcatttgttgcaacagttccggcagagtgccacacgcagtttcctt
gatgcctatctggaggttttgcgttcagcagatacgccctgggttcagccggaagggatc
gagccactgctgacgctgttcctgattgaaaaagctgcctacgaaatacgctacgaagcc
gccaaccggccgggctggatcggcattccagtggcggggctgtaccatctggttttcggt
gcatccccctcctctccggctaccgatgaaggacattcctga

DBGET integrated database retrieval system