KEGG   Geobacter bemidjiensis: Gbem_0020Help
Entry
Gbem_0020         CDS       T00749                                 

Gene name
macA
Definition
cytochrome c
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Gbem_0020 (macA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(26479..27516)
Genome map
AA seq 345 aa AA seqDB search
MKGKWIILLLPLLPGCVDATAKETMSKAQATFKPIPAQAPAIKGNEATKAKVDLGRMLFF
DPRLSTSQLISCNTCHNVGLGGADLQETSVGHGWQKGPRNAPTVFNAVYNVAQFWDGRAK
DLQTQAKGPVQASVEMNSNPELVVRTLKNIPGYPALFEAAFPGYRDPVTFDNMAKAIEVF
EATLVTPDAPFDHFLNGEPSALNAREQTGLGVFMEKGCAACHGGINIGGAAYYPFGVREI
PTAEIRPESDTGRFKVTNTASDKYVFRAPSLRNVALTQPYFHSGKVWSLKDAVVVMGSAQ
LGMKLNETEVNDTVAFLKSLTGKQPKIDYPLLPPSSDQTPHPQLK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcaaatggatcatactgctcctgccactgcttcccggctgcgtcgatgccact
gcgaaggaaacgatgtccaaggcccaggccaccttcaagcccatcccggcacaggccccg
gccatcaaagggaacgaggccaccaaggccaaggtcgacctagggagaatgctcttcttc
gatccccgcctctccacctcgcaactcatcagctgcaacacctgccataacgtagggttg
ggaggcgcggacctccaggaaacctcggtcggccacggctggcagaaaggcccccgcaac
gcccccaccgttttcaacgccgtctacaacgtagcccagttctgggatggcagggccaag
gacctgcagacccaggccaagggcccggtgcaggcgtccgtagagatgaacagcaatccc
gagctggtagttagaaccttgaagaacatcccgggatatccagccctcttcgaggcggct
tttcccgggtaccgcgatccggtcaccttcgacaacatggcgaaggctatcgaggtgttc
gaggcgacactggtaactccggatgccccgttcgaccacttcctcaacggcgaacccagc
gctctcaacgcgcgcgagcagactggccttggtgtcttcatggagaaagggtgcgccgcc
tgccacgggggaatcaacatcggcggtgccgcctactaccccttcggcgtccgtgagata
cccactgcagagatccgcccggaaagcgacacggggcgtttcaaggtgaccaataccgcc
agcgataagtacgttttccgggcgccgtcgctcaggaacgtcgcgctcacccaaccctat
ttccattccggaaaggtgtggagcctcaaggatgcggtggtggtgatggggtctgcgcaa
ctgggaatgaaattgaacgagacggaagtgaacgacaccgtcgcattcctaaagagcctg
acgggaaaacaacctaagattgattaccctctgcttccgccgagttcggaccagaccccg
catccgcagctaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system