KEGG   Geobacter bemidjiensis: Gbem_0260Help
Entry
Gbem_0260         CDS       T00749                                 

Gene name
sucC-1
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00020  Citrate cycle (TCA cycle)
gbm00640  Propanoate metabolism
gbm00660  C5-Branched dibasic acid metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
Module
gbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbem_0260 (sucC-1)
   00640 Propanoate metabolism
    Gbem_0260 (sucC-1)
   00660 C5-Branched dibasic acid metabolism
    Gbem_0260 (sucC-1)
Enzymes [BR:gbm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gbem_0260 (sucC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACH37291
JGI: Gbem0260
UniProt: B5E9Z3
Position
complement(309159..310319)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILSTFGIPVPRGRVALTADQVERAAKEMGGRCVVKAQIYAGGRGKAGGVK
LVHHPEQAQDLAKELFGKTLVTPQTGPEGLKVRRILVEEAVDIAREFYLSITLDRGTSRY
ILIASAEGGMEIEEVATRSPEKIHTLTIDPFTGLRSFQARHIALQLGLSGSVCEDCVSLI
LNLYRVCLEKDCALVEINPLVVTRAGWLMAMDAKITFDDNAIFRHREYPDMMDYSQLDPL
EINAGKYDLAYIKLTGTIGCLVNGAGLAMATLDVLKEFGGEPANFLDVGGGATREKVAEA
FKIILQDSDVKGIFVNIFGGIMRCDVIAHGIIEAASEVNCTLPIVVRMDGSQVEEGKRLL
TESGLNVQCGDNLGDAAARIVKMLAG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcaggcgaaggaaatactgagcacattcgggatcccggtgccc
cgcgggcgtgtggccctgaccgcggaccaagtcgagcgcgccgcgaaggagatgggcggg
cgctgcgtggtcaaggcccagatctacgccggcggacgcgggaaggccggcggggtcaag
ctggtgcaccaccccgaacaggcccaggacctcgccaaggagctgttcggaaagaccctg
gtgaccccgcagaccgggccggaagggctcaaggtgaggcgcatcctggtcgaggaggcg
gtcgacatcgcccgcgaattctacctctccattaccctggaccgcggcacttcccgctac
atcctgatcgcctccgcagagggggggatggagatagaggaagtggcgacgaggagcccg
gaaaagatccacaccctaaccatcgaccccttcaccgggctcaggtcgttccaggcgcgc
cacatcgccctgcagctgggcctctccgggagcgtctgcgaggactgcgtcagcctcatc
ctcaacctctaccgcgtctgcctggagaaggactgcgccctggtggagatcaacccgctg
gtggtgacccgcgccggttggctcatggccatggatgccaagatcaccttcgacgacaac
gccatcttcagacaccgggaataccccgacatgatggactactcccagttggaccccctg
gagatcaacgcagggaaatacgatctcgcctacatcaagctcaccggcaccatcggctgc
ctagtgaacggcgcaggcctcgccatggctaccctagacgtcctgaaggaattcggcggc
gagcctgcgaacttcctcgacgtcggagggggggccacccgcgagaaggtggccgaggcg
ttcaagatcatccttcaggacagcgacgtgaaagggatcttcgtcaacatcttcggcggg
atcatgcgctgcgacgtgatcgcccacggcatcatcgaggccgccagcgaggtgaactgc
accctccccatagtagtccgcatggacgggagccaggtcgaggaagggaagaggcttctt
accgagagcggcctcaacgtgcaatgcggcgacaaccttggggacgcggccgcgcgaatc
gtgaagatgctggcggggtag

DBGET integrated database retrieval system