KEGG   Geobacter bemidjiensis: Gbem_0312Help
Entry
Gbem_0312         CDS       T00749                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gbm01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gbm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(384678..386480)
Genome map
AA seq 600 aa AA seqDB search
MSGKPGYHGKILNIDLSTGKIETVPVPAEDFDKFVGGQGLGMKILWDRLKKPGVDPLSPD
NLLMFMPGPFSGLPVPSSSRTCVVTKSPITSPLKSDYTHPSTVTYSNMGGFFGPEVRFAG
YDGIVITGKARVLSYVVIEDDKVEIREAAKFKGMRTDAFDRAFLAELGDRRFKTVYIGPA
GENLVPYSSILHTAGRAAGRGGTGCVMGSKNLKAIAVRGTGQPTVADHKAFLAALENARR
ALNGSAFAKSWAEQGTARAIVGNSNAGTEAVRNYREGTFTEADKIGGDAARRDVWVKDIA
CYCCPLACKKSGMTKGKHGGVVHDGPEYETGVMLGSNLMISDMPGLLKAITTIDDLGLDQ
ISTGNVIGFLMEAYERGLINRSFLDGIDLKWGSVDATLAMIEKIAAKEGVGALAAEGVRG
LSWHIGKGSDKFAIQVKGLELAAHNIQANQPRGLSYVTASRGACHMSGDNIAMQNRRAMM
DSTGMCFFPTFEPTLEEPMLALLSAITGRKFDKAEFEKVGERIFTLEKLFNYREGFRRED
DRLPDRFFEDAFTVGPKKGAVLDREKFESMLTQYYQDRGWDPETTEPGKKKLKELGLDTI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaaaccgggttatcacggcaagatattgaacatagacctttccaccgggaag
attgaaacggtgcccgtccccgccgaagacttcgataagttcgtgggcgggcagggactg
ggcatgaagatactctgggaccggctgaagaagccgggcgtcgacccgctttctccggat
aacctgctcatgttcatgccgggaccgttttccgggcttccggtcccgtcctcgtccagg
acctgcgtggtgaccaaatcccctatcacgtcgcctttgaaatccgactacacgcacccg
tccaccgtcacctactcgaacatgggaggctttttcggacccgaagtccgctttgccggc
tatgacggcatcgtgatcaccggcaaggcgcgggtgctttcctatgtcgtgattgaggac
gacaaagtggagattcgcgaagccgccaagttcaaggggatgcgaaccgatgccttcgac
cgggcgttcctggcggaactgggggaccggcgattcaaaacggtatacatcggccctgcc
ggggagaatctcgttccctattccagcatcctgcataccgcagggcgggcagcaggccgg
ggcggtaccggctgcgtcatgggttccaagaatctgaaagccattgcggtgcgaggcacg
ggacaaccgactgtcgccgatcataaagcgttccttgccgcgcttgaaaacgccagacgc
gccctcaacggttccgcctttgccaaatcctgggcggagcaggggacggcgcgggccatc
gtcggcaacagcaatgccggtaccgaggcggttcgcaactatcgcgaagggactttcacg
gaggctgacaagatcggcggcgatgccgcccggcgcgatgtctgggtaaaggacatagcc
tgttactgttgtccgctcgcctgcaagaaaagcggtatgacgaagggtaaacacggcggg
gtcgtccacgacggacccgagtacgaaaccggcgtgatgctcggttcaaacctgatgatt
tccgatatgcccggactgctgaaggcgataaccaccatcgacgatctcggcctggaccag
atctccaccggcaacgtcatcggctttctcatggaagcgtacgagcgtgggttgatcaat
cggagttttctagacggcatcgaccttaaatggggaagtgtcgatgcgacgctggcgatg
atcgagaagattgccgccaaggagggggtgggagccctggccgccgagggggtgcggggc
ctttcctggcatatcggcaaagggagcgacaagtttgccatccaggtgaaagggcttgag
ctcgctgcccacaacatccaggcaaatcagccacgggggctttcctacgtgacagcgtcg
cggggggcctgccacatgagcggagacaacattgccatgcagaacaggcgggccatgatg
gattccaccggcatgtgctttttccctaccttcgaaccgacgctggaagaaccgatgtta
gcgctgctcagtgccataaccggccggaaattcgacaaggcagagttcgaaaaagtgggc
gagcgaatcttcaccctggaaaagctgttcaattaccgcgaggggtttcgccgcgaagac
gaccgtctcccggaccgttttttcgaggatgccttcaccgttggaccgaaaaagggagcg
gtgctggaccgggagaagttcgagagcatgctcacccagtattaccaggatcgcggatgg
gatccggagaccaccgagcccggaaagaagaagctgaaggaactggggctggataccatt
tag

DBGET integrated database retrieval system