KEGG   Geobacter bemidjiensis: Gbem_0312Help
Entry
Gbem_0312         CDS       T00749                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_0312
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gbem_0312
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Gbem_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(384678..386480)
Genome map
AA seq 600 aa AA seqDB search
MSGKPGYHGKILNIDLSTGKIETVPVPAEDFDKFVGGQGLGMKILWDRLKKPGVDPLSPD
NLLMFMPGPFSGLPVPSSSRTCVVTKSPITSPLKSDYTHPSTVTYSNMGGFFGPEVRFAG
YDGIVITGKARVLSYVVIEDDKVEIREAAKFKGMRTDAFDRAFLAELGDRRFKTVYIGPA
GENLVPYSSILHTAGRAAGRGGTGCVMGSKNLKAIAVRGTGQPTVADHKAFLAALENARR
ALNGSAFAKSWAEQGTARAIVGNSNAGTEAVRNYREGTFTEADKIGGDAARRDVWVKDIA
CYCCPLACKKSGMTKGKHGGVVHDGPEYETGVMLGSNLMISDMPGLLKAITTIDDLGLDQ
ISTGNVIGFLMEAYERGLINRSFLDGIDLKWGSVDATLAMIEKIAAKEGVGALAAEGVRG
LSWHIGKGSDKFAIQVKGLELAAHNIQANQPRGLSYVTASRGACHMSGDNIAMQNRRAMM
DSTGMCFFPTFEPTLEEPMLALLSAITGRKFDKAEFEKVGERIFTLEKLFNYREGFRRED
DRLPDRFFEDAFTVGPKKGAVLDREKFESMLTQYYQDRGWDPETTEPGKKKLKELGLDTI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaaaccgggttatcacggcaagatattgaacatagacctttccaccgggaag
attgaaacggtgcccgtccccgccgaagacttcgataagttcgtgggcgggcagggactg
ggcatgaagatactctgggaccggctgaagaagccgggcgtcgacccgctttctccggat
aacctgctcatgttcatgccgggaccgttttccgggcttccggtcccgtcctcgtccagg
acctgcgtggtgaccaaatcccctatcacgtcgcctttgaaatccgactacacgcacccg
tccaccgtcacctactcgaacatgggaggctttttcggacccgaagtccgctttgccggc
tatgacggcatcgtgatcaccggcaaggcgcgggtgctttcctatgtcgtgattgaggac
gacaaagtggagattcgcgaagccgccaagttcaaggggatgcgaaccgatgccttcgac
cgggcgttcctggcggaactgggggaccggcgattcaaaacggtatacatcggccctgcc
ggggagaatctcgttccctattccagcatcctgcataccgcagggcgggcagcaggccgg
ggcggtaccggctgcgtcatgggttccaagaatctgaaagccattgcggtgcgaggcacg
ggacaaccgactgtcgccgatcataaagcgttccttgccgcgcttgaaaacgccagacgc
gccctcaacggttccgcctttgccaaatcctgggcggagcaggggacggcgcgggccatc
gtcggcaacagcaatgccggtaccgaggcggttcgcaactatcgcgaagggactttcacg
gaggctgacaagatcggcggcgatgccgcccggcgcgatgtctgggtaaaggacatagcc
tgttactgttgtccgctcgcctgcaagaaaagcggtatgacgaagggtaaacacggcggg
gtcgtccacgacggacccgagtacgaaaccggcgtgatgctcggttcaaacctgatgatt
tccgatatgcccggactgctgaaggcgataaccaccatcgacgatctcggcctggaccag
atctccaccggcaacgtcatcggctttctcatggaagcgtacgagcgtgggttgatcaat
cggagttttctagacggcatcgaccttaaatggggaagtgtcgatgcgacgctggcgatg
atcgagaagattgccgccaaggagggggtgggagccctggccgccgagggggtgcggggc
ctttcctggcatatcggcaaagggagcgacaagtttgccatccaggtgaaagggcttgag
ctcgctgcccacaacatccaggcaaatcagccacgggggctttcctacgtgacagcgtcg
cggggggcctgccacatgagcggagacaacattgccatgcagaacaggcgggccatgatg
gattccaccggcatgtgctttttccctaccttcgaaccgacgctggaagaaccgatgtta
gcgctgctcagtgccataaccggccggaaattcgacaaggcagagttcgaaaaagtgggc
gagcgaatcttcaccctggaaaagctgttcaattaccgcgaggggtttcgccgcgaagac
gaccgtctcccggaccgttttttcgaggatgccttcaccgttggaccgaaaaagggagcg
gtgctggaccgggagaagttcgagagcatgctcacccagtattaccaggatcgcggatgg
gatccggagaccaccgagcccggaaagaagaagctgaaggaactggggctggataccatt
tag

DBGET integrated database retrieval system