KEGG   Geobacter bemidjiensis: Gbem_0410Help
Entry
Gbem_0410         CDS       T00749                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gbm  Geobacter bemidjiensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gbem_0410 (hemB)
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Gbem_0410 (hemB)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbem_0410 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
486824..487843
Genome map
AA seq 339 aa AA seqDB search
MFYPLYRARRIRGKEVFRNMVRETSLSANDLIYPMFSAFGKGIKKEISSMPGIYQQSIEN
IVEEAQEVYELGVPAVILFGIPEQKDAMGTDAYSDTGIIQETIRAIKKSVPKLAVITDVC
MCEYTDHGHCGVIKNGDVDNDETLELLAKEALSHAKAGADMVAPSDMMDGRVAAIRESLD
NNGFNQIPLMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPANRLEAIREARMDVEE
GADILMVKPGLPYLDIVREVRNEFNLPTAVYNVSGEYSMIKSAAKMGWIDEDRVIMETMM
SFKRAGADLILTYHSKEVAKLLRKGYEADISDRCGCGCR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttctacccactgtacagagcgagaaggatccggggcaaagaagtcttcagaaacatg
gtcagggagacctcgctttccgccaatgacctcatatacccgatgttttccgccttcggc
aaagggatcaagaaagagatctcctccatgcccggcatctatcagcagtccatcgagaac
atcgtcgaggaggcgcaggaagtttacgagctgggtgttcccgccgtcatcctcttcggc
attcccgagcagaaggacgccatggggaccgacgcctactccgacaccgggatcatccag
gagaccattcgcgccatcaagaaatccgttcccaagctcgccgtcatcaccgacgtctgc
atgtgcgagtacaccgatcacggccattgcggcgtgatcaaaaacggcgacgtcgacaac
gacgagaccctggagctgctcgccaaagaagccctttcccatgccaaggccggtgccgac
atggtcgcaccctccgacatgatggacgggcgcgtcgcagccatccgcgagtctttggac
aacaacggcttcaaccagatcccgctgatgagctacgccgtcaagtacgcttccgggtac
tatggtccgttcagggaagccgccgagtccacgccgcagttcggcgaccgtcgttcctac
cagatggatccggctaaccggctcgaagccatccgcgaagcacgcatggacgtcgaagaa
ggcgccgacatcctcatggtgaaacccggccttccctacctcgacatcgtgcgcgaggtg
aggaacgagttcaacctcccgaccgccgtgtacaacgtctccggcgagtacagcatgatc
aagtccgccgccaagatgggttggatcgacgaagaccgcgtcattatggagaccatgatg
tccttcaagcgtgccggtgccgacctgatcctgacctatcactccaaagaagtagccaag
cttttgaggaaagggtacgaagccgacatcagcgatcgctgcggctgcggctgcaggtaa

DBGET integrated database retrieval system