KEGG   Geobacter bemidjiensis: Gbem_0461Help
Entry
Gbem_0461         CDS       T00749                                 

Gene name
bkdF
Definition
(GenBank) branched-chain 2-oxoacid dehydrogenase complex, E2 protein, dihydrolipoamide acyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00020  Citrate cycle (TCA cycle)
gbm00620  Pyruvate metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
Module
gbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_0461 (bkdF)
   00020 Citrate cycle (TCA cycle)
    Gbem_0461 (bkdF)
   00620 Pyruvate metabolism
    Gbem_0461 (bkdF)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gbem_0461 (bkdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACH37490
JGI: Gbem0461
UniProt: B5EBM1
Position
554561..555781
Genome map
AA seq 406 aa AA seqDB search
MSIDFKLPDLGEGIAEVELRRWLVAEGDAVAEHQPLVEVETDKAVVEVPSPRAGVVARLH
CKEGETVQVGATLVTFAEAKEAAKKEEPEGERRPAQRPPSVGIVGSLPEPEEEATPAAPA
GFEGLATPMVRKMARERGIDLKSVRGTGPRGCIKPEDLDQVPLAAQKAKPAPPDGERVPL
RGLRRTIARNVLASQRTTAFVTSMEEVDITDIWEMRGREQGEVESRGAHLTFLPFFIKAV
QHALREHPLLNGSIDDEAQELVLKKHYHFGIAVDTPEGLMVPVIRDVDKKSIIELAQAVQ
ELGRKARERSISLEELRGSSFTITNYGHFGGTFATPIINWPDVAIMGFGRIVERPWVHRG
QIAIRKILPLSLTFDHRATDGADAARFLGKVLRYLEDPALLFLDSA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgatttcaaactccccgatctgggcgaaggcatcgccgaggtggaactgcgc
cgctggctggtggcggaaggggatgctgttgcggaacaccagccgctggtcgaggtggag
acggacaaggcggtggtcgaggtcccatccccgcgcgccggtgtcgtcgcccgccttcac
tgcaaggagggggagacggttcaggtcggcgccacgctggtgactttcgccgaggcgaag
gaggccgccaagaaagaggagcccgaaggggagcgcaggccggcgcagcgcccgccctcg
gtcggcatcgtcggctcgctgccggaaccggaggaggaggcaactccggccgcaccggcg
gggttcgagggactggcgaccccgatggtgaggaagatggcccgggagcggggtatcgac
ctgaaaagcgtgcggggcaccgggccgcgcggctgcatcaagcccgaggatctggaccag
gttcccctggcggcgcagaaagcgaagccggcgccgccagacggggaacgggtgccgctc
agaggcctgcggcgtaccatcgcccggaacgtgctggcctcccaaaggaccaccgccttc
gtcaccagcatggaagaggtcgacattaccgacatatgggagatgcgggggcgcgagcag
ggggaagtggagtcgcggggggcgcacctgaccttcctccccttcttcatcaaggcggtc
cagcatgcgctgcgcgaacacccgcttttgaacggctccatcgacgacgaggcgcaggaa
ctggtgctgaaaaagcactaccatttcgggatcgcggtggacaccccggaggggctcatg
gtcccggtgatccgggacgtggacaagaagagcatcatcgagctggcgcaggcggtccag
gaactcggccgcaaggcgcgcgagcggagcatttcgttggaggaactgcgcggcagcagt
ttcaccatcaccaactacggccacttcggcggcaccttcgccactcccatcatcaactgg
cccgacgtcgccatcatgggctttgggcgcatcgtagaacgcccctgggtgcaccggggc
cagatcgccatcaggaagatcctgccgttgtcgctcaccttcgaccaccgcgccaccgac
ggcgccgacgccgccaggttcctgggcaaggtgctccgctacctcgaggaccccgcgctc
ctcttcctggacagcgcctag

DBGET integrated database retrieval system