KEGG   Geobacter bemidjiensis: Gbem_0545Help
Entry
Gbem_0545         CDS       T00749                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Gbem_0545
Enzymes [BR:gbm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Gbem_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(658009..659007)
Genome map
AA seq 332 aa AA seqDB search
MNSKDIPMVPNRKASLPTVYGDTPSFLGVPVLDYRKPAAGYDVMIAGVPWEGTVTWGSFT
GCELAPRSIRHASARYGGFLPEYEIDLFDHLTLGDIGDIPVHPNDPAETMRNVHAAMQRV
YRNQSIPFVLGGDHSFTPEIIRALADGEEGKIGVIHLDAHLDNAKSFGSDQFARCGPIHR
ISQIPQVRKESIVHLGIRGPRNSPTQYEYAQSMGARVITTREVRERGMSAVTEEAIRIAH
HETRHVFVTICSDCIDAGYNPGGPADFNGLLPSELLPALHQIGASGISGLDYVEVYPGQD
PQGYSSHLAAWAMIYALSGMAQRKRDRPGPDR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagacatccccatggttcccaacaggaaggcctcgctccctaccgtgtac
ggcgacactccctcctttctcggcgtacccgttctcgactacaggaaaccggcagcaggc
tacgacgtgatgatcgccggggtcccatgggaagggaccgtcacctggggctccttcaca
gggtgcgagctagcgcccaggagcatccgccacgcctcggcgcgttacggtggattcctc
cccgagtacgagatcgacctgttcgaccacctgacgctcggcgacatcggggacattccg
gtacaccccaacgaccccgccgagaccatgcgcaacgtgcacgctgccatgcagcgggtc
taccgcaaccagagcatccccttcgtgctgggaggcgaccactccttcaccccggagatc
atcagggcgctcgcggacggagaagagggcaaaatcggcgtcatccacctggacgcacac
ttggacaacgccaagtccttcggcagcgaccagttcgcccgttgcggcccgatccacagg
atttcccaaatcccgcaggtccgcaaagagagcatcgtgcatctgggcatccgcggcccg
cggaactcacctacccagtatgagtacgcccaaagcatgggggcgcgcgtcatcaccacc
agggaagtcagggaaagggggatgagcgccgtcaccgaggaagcgatacggatcgcgcac
cacgagacgaggcacgtcttcgtcaccatctgcagcgactgcatcgatgccggttacaac
ccgggaggtcccgccgatttcaacgggctgctccccagcgaactgctgccggcgctgcac
caaatcggagcctcggggatcagcggcctcgattacgtcgaggtctatcccggccaggac
ccgcagggatattcgtcgcacctggccgcctgggcgatgatctacgcgctttcggggatg
gcgcagcgcaagcgcgaccggccgggaccggaccggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system