KEGG   Geobacter bemidjiensis: Gbem_0608Help
Entry
Gbem_0608         CDS       T00749                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00790  Folate biosynthesis
gbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gbem_0608 (folK)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Gbem_0608 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACH37636
JGI: Gbem0608
UniProt: B5ED50
Position
729656..730144
Genome map
AA seq 162 aa AA seqDB search
MEERAYIGLGSNLGDRELKLLMAVAELGKLPGTRVTGVSQFYETEPVGGVPQDNFYNAVA
RIETTLSPFLLLDELKRVETEVFQRKPSERWGARSMDLDILLYGELVLDSDRLTIPHPRL
AERRFALQPLADLAPDLVYPVTGKTVSQLLAALTATEKVVKL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagcgcgcctacatagggttggggagcaacctcggcgaccgcgagctgaagcta
ctgatggccgtcgccgaactggggaagctccccggaacgcgggtcaccggcgtgtcccag
ttctacgagaccgagcccgtggggggcgttccccaggacaacttctacaacgccgtggcg
cgcattgaaacgacactctctcctttcctgctcctggacgagttgaagcgggtggagacc
gaagtcttccagcgcaagccttcagagcgctggggcgcccgcagcatggacctggacatc
ctcctctacggggagctggtgctcgactcggaccggctcaccattccgcacccgcgcctg
gcggagcggcgtttcgcgctgcagccgctggccgacctcgcccccgacctagtgtatccc
gtcacaggcaaaaccgtctcgcagcttttggctgcacttaccgccaccgagaaggtggtc
aagctttag

DBGET integrated database retrieval system