KEGG   Geobacter bemidjiensis: Gbem_0705Help
Entry
Gbem_0705         CDS       T00749                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 protein, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gbm  Geobacter bemidjiensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_0705 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbem_0705 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Gbem_0705 (sucB)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gbem_0705 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835431..836702
Genome map
AA seq 423 aa AA seqDB search
MDIKVPAVGESVYEAVIARWLKKSGEVVAKDEPLCEVETDKVTLEVTSEADGVLTTLAAE
GETVKIGAVIATIDARGAEAAPPSGSAAPPEPPPSGAPAAGTAPAKATPKGMAPPISPSG
RKLARELGVEPQDVKGTGRGGRVTREDLLKAEGAEPAPAEAEPSPAAQLAPVGKTEPAPA
APPRPAPAEEAERVVRKPMTQIRKRIAERLVSVRQQTAMLTTFNEADMSQVMLLRQKYGE
HFLKRHGVKLGFMSFFVRACCEALAQYPEVNAQIDGDDIVYHNFCDIGVAVGSERGLVVP
VLRGAESLTLAGIEQQIAQYAEKVRQNRIAIADLEGGTFTISNGGVYGSMLSTPILNPPQ
SGVLGMHAIQPRAVVVDGEIVVRPMMYLALSYDHRIVDGQGAVGFLKLVKEYIEEPEELL
LEG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaggttcccgcggtgggtgagtcggtctatgaggcggtcatcgccaggtgg
ctcaagaagtcgggcgaggttgtggccaaggatgagccgctttgcgaggttgaaacggac
aaggtgaccctggaggtgacctcggaggcggacggcgtgttgaccacgctggcggccgag
ggggagacggtgaagatcggcgcggtgatcgcgaccatagacgcccgcggcgcagaggcc
gcgcccccctcggggagcgccgcccctcctgagcccccgccttccggcgccccggcagcc
gggaccgccccggccaaagcgacccccaagggtatggcgcctcccatctccccatcgggg
cgcaagctggcacgcgagctgggcgtggagccccaggatgtcaaggggaccgggcgcgga
gggcgcgtgaccagggaagaccttttgaaggcggagggggcagagcccgctcccgccgag
gccgaaccctcccctgcggcacagcttgcgccggtcgggaaaaccgagccggcacccgct
gctccgccccgtcccgccccagccgaagaagcggagcgcgtggtccgcaagccgatgacg
cagatcagaaagcgcattgcggagcggctggtctcggtgcggcagcagaccgccatgctc
accaccttcaacgaggcggacatgagccaggtgatgctgctgcgccagaagtacggggaa
catttcctgaagcgccacggcgtgaagctggggttcatgtcctttttcgtccgcgcctgc
tgcgaggcgctggcgcagtatcccgaggtgaacgcgcagatcgatggcgacgacatcgtc
taccacaacttctgtgacatcggcgttgccgtcgggagcgaaagggggctggtggtaccg
gtcttgagaggtgccgagtcgctcaccctcgccgggatcgagcagcagatcgcacaatac
gccgagaaggtgcgccaaaaccgcatcgccatcgccgaccttgagggggggaccttcacc
atctccaacggcggggtctacggttccatgctctccacccccatcctcaacccgccgcaa
agcggggtgctggggatgcacgcgatacagccgcgcgccgtggtcgtcgacggcgagatc
gtggtccgccccatgatgtacctggcgctctcctacgatcaccgcatcgtggacgggcag
ggggcggtggggtttttgaagctggtcaaggagtacatcgaggagccggaggagttgctg
ctcgaagggtag

DBGET integrated database retrieval system