KEGG   Geobacter bemidjiensis: Gbem_0705Help
Entry
Gbem_0705         CDS       T00749                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 protein, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gbm  Geobacter bemidjiensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_0705 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbem_0705 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Gbem_0705 (sucB)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gbem_0705 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835431..836702
Genome map
AA seq 423 aa AA seqDB search
MDIKVPAVGESVYEAVIARWLKKSGEVVAKDEPLCEVETDKVTLEVTSEADGVLTTLAAE
GETVKIGAVIATIDARGAEAAPPSGSAAPPEPPPSGAPAAGTAPAKATPKGMAPPISPSG
RKLARELGVEPQDVKGTGRGGRVTREDLLKAEGAEPAPAEAEPSPAAQLAPVGKTEPAPA
APPRPAPAEEAERVVRKPMTQIRKRIAERLVSVRQQTAMLTTFNEADMSQVMLLRQKYGE
HFLKRHGVKLGFMSFFVRACCEALAQYPEVNAQIDGDDIVYHNFCDIGVAVGSERGLVVP
VLRGAESLTLAGIEQQIAQYAEKVRQNRIAIADLEGGTFTISNGGVYGSMLSTPILNPPQ
SGVLGMHAIQPRAVVVDGEIVVRPMMYLALSYDHRIVDGQGAVGFLKLVKEYIEEPEELL
LEG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaggttcccgcggtgggtgagtcggtctatgaggcggtcatcgccaggtgg
ctcaagaagtcgggcgaggttgtggccaaggatgagccgctttgcgaggttgaaacggac
aaggtgaccctggaggtgacctcggaggcggacggcgtgttgaccacgctggcggccgag
ggggagacggtgaagatcggcgcggtgatcgcgaccatagacgcccgcggcgcagaggcc
gcgcccccctcggggagcgccgcccctcctgagcccccgccttccggcgccccggcagcc
gggaccgccccggccaaagcgacccccaagggtatggcgcctcccatctccccatcgggg
cgcaagctggcacgcgagctgggcgtggagccccaggatgtcaaggggaccgggcgcgga
gggcgcgtgaccagggaagaccttttgaaggcggagggggcagagcccgctcccgccgag
gccgaaccctcccctgcggcacagcttgcgccggtcgggaaaaccgagccggcacccgct
gctccgccccgtcccgccccagccgaagaagcggagcgcgtggtccgcaagccgatgacg
cagatcagaaagcgcattgcggagcggctggtctcggtgcggcagcagaccgccatgctc
accaccttcaacgaggcggacatgagccaggtgatgctgctgcgccagaagtacggggaa
catttcctgaagcgccacggcgtgaagctggggttcatgtcctttttcgtccgcgcctgc
tgcgaggcgctggcgcagtatcccgaggtgaacgcgcagatcgatggcgacgacatcgtc
taccacaacttctgtgacatcggcgttgccgtcgggagcgaaagggggctggtggtaccg
gtcttgagaggtgccgagtcgctcaccctcgccgggatcgagcagcagatcgcacaatac
gccgagaaggtgcgccaaaaccgcatcgccatcgccgaccttgagggggggaccttcacc
atctccaacggcggggtctacggttccatgctctccacccccatcctcaacccgccgcaa
agcggggtgctggggatgcacgcgatacagccgcgcgccgtggtcgtcgacggcgagatc
gtggtccgccccatgatgtacctggcgctctcctacgatcaccgcatcgtggacgggcag
ggggcggtggggtttttgaagctggtcaaggagtacatcgaggagccggaggagttgctg
ctcgaagggtag

DBGET integrated database retrieval system