KEGG   Geobacter bemidjiensis: Gbem_0763Help
Entry
Gbem_0763         CDS       T00749                                 

Definition
(RefSeq) glutamyl aminopeptidase M42
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gbm  Geobacter bemidjiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbem_0763
Enzymes [BR:gbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Gbem_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
897974..899044
Genome map
AA seq 356 aa AA seqDB search
MRDASFEFLQQLLAAPSPSGYEQPAQRVFRSYIEPFCQVATDVMGNVFGMIQGAGNNRPR
IMVVGHSDEIGLQVRYLDDNGFIYFSAIGGVDPHITPGMRVHVHTAKGKLNGVIGKRPIH
LIEPKERDTVIKLDAQYIDIGAANKKEALEWVRVGDPITFDSNLERLFGDRVSSRGLDDK
AGSFVVAEVLRRVSELPDQLPIDLYGVSSVQEEVGLRGGTTSSYSVNPDVGICVEVDFAT
DQPDVDKKHNGEVGLGKGPILPRGANINPVLFDLLSDTATGNGIVVQYTGIARATGTDAN
VMQISRGGVATALVKIPLRYMHTPVETLSLADLDGAVELIVASLAKMGHKEAFIPM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcatctttcgaattcctgcagcaattgctggcggcgcccagcccctcgggg
tacgagcagcctgcccagcgggtcttccgctcctacatagaacccttctgccaggtggcg
accgacgtcatggggaacgtcttcggcatgatccagggagcgggaaataaccgcccacgc
atcatggtcgtcgggcactccgacgagatcgggctccaggtccgctatctggacgacaac
ggtttcatctatttctccgccatcggcggggtcgacccccacatcacccccggcatgcgg
gtccacgtacataccgccaaagggaagctgaacggcgtgatcggcaagcgccccatccac
ctgatcgagcccaaggagcgcgacacggtgatcaagctggacgcccagtacatagacatc
ggcgccgccaacaagaaagaggccctggagtgggtgcgggtaggcgatcccatcaccttc
gacagcaacctggagcggctcttcggggaccgcgtcagttcgcgcggactcgacgacaag
gccggcagcttcgtggtagccgaagtgctccgccgcgtctccgagcttcccgatcagctc
cccatcgacctctacggcgtctcctcggtccaggaggaggtcggcctgcgcggcggcact
accagcagctactcggtgaaccccgacgtcggcatctgcgtcgaggtggatttcgccacc
gaccagcccgacgtggacaaaaagcacaacggcgaagtaggcctcgggaaggggccgatc
cttccgcgcggcgccaacatcaacccggtcctcttcgaccttctttccgacaccgccacc
ggcaacggcatcgtggtccagtacaccggcatcgcccgggcgaccggcaccgacgccaac
gtcatgcagatctcccgtgggggcgtcgccaccgccctggtgaagattccgctgcgttac
atgcacaccccggtggagaccctgtcccttgccgacctggacggggcggtcgagctgatc
gtcgcctcgcttgccaagatggggcacaaggaagcgttcatcccgatgtga

DBGET integrated database retrieval system