KEGG   Geobacter bemidjiensis: Gbem_0815Help
Entry
Gbem_0815         CDS       T00749                                 

Gene name
mutM-2
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gbm  Geobacter bemidjiensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gbm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
965421..966206
Genome map
AA seq 261 aa AA seqDB search
MPELPDLTIYAENLARKLTGKKIATVSFHDRGRLNVAPDELSAALIGAKVTAVRRTGKQV
SFQADNGAMLRVHLMLTGGFVLTSTEHLDRLEAPVVTVTFNDGSALAVSDPKGWATLTLN
PQPEREAPDALELSADQLQQLCAKQPKALIKALLLDQALIGGIGNAYADEILWEARISPK
SVAGKLPPEAVSALARAIPAVLKDAISELRKRHPDMVAGEYREFLKVHRPGLKQSPTGAP
VIKENISSKQTYYTDEQQLYK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgccggatctcaccatatacgcggagaacctggccaggaagctgaccggg
aagaagatagcgacagtttccttccatgacaggggacgtctgaacgtagctcccgatgaa
ctatccgccgcgctcataggtgcaaaggtcaccgccgtgcgcaggaccggaaagcaggtt
tctttccaggccgacaacggcgccatgttgcgggttcacctcatgctgaccggcggcttc
gtgctgaccagcaccgagcatctggaccgtctggaggcgccggtggtgactgtcaccttc
aacgacggttccgcgctcgcggtttcggatcccaaggggtgggcgacgctcaccttgaac
ccgcagccggagcgggaggcgccggacgccttggagctaagcgccgatcagttgcagcag
ctgtgcgcgaagcagccgaaggcgctgatcaaggcgctgctcctggaccaggcgctcatc
ggcggcatcggcaacgcctacgccgacgaaatcctgtgggaggcgcgcatctcccccaaa
tcggtggcgggaaagcttccccccgaggcggtctcggcgctggcgcgggccattcccgcc
gttctcaaggacgccatatcggaactccgcaaacgccacccggacatggtcgccggcgag
taccgcgagtttctcaaggtgcaccgccccggcctgaagcaatcccccaccggcgcgccc
gtcatcaaggagaacatctcctccaagcagacctactacaccgacgaacagcagctctac
aaataa

DBGET integrated database retrieval system