KEGG   Geobacter bemidjiensis: Gbem_0817Help
Entry
Gbem_0817         CDS       T00749                                 

Gene name
malQ-2
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gbm  Geobacter bemidjiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbem_0817 (malQ-2)
Enzymes [BR:gbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Gbem_0817 (malQ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(967111..968604)
Genome map
AA seq 497 aa AA seqDB search
MKKRGSGILCHITSLPSPFGIGDFGAGAYGFADFLCEAKQSYWQILPLNPTNKRYFDSPF
SSLSSCAGNTALISPELLAAEGLLTQQEVEDRPRFPEHRVDYQAASRFKRQLFQRAHTRF
QKGGVPEDYARFCRGNSMWLEDHALFTALSNHLGNAPLTEWPQELINRNSEKVQLLREEF
WDEVELEKFLQYLFFKQWHLLKNYCNGKGIRIIGDFPMFMNYDAVDIWTNPELFKVDERK
KPYVLAGSPPDAFSAEGQLFNCAVYDWDGLKRNGFNWWIRRFHYLFRQYDFVRIDHFRGL
ISYWEVPAGEQNGLRGSWQQTPTQEFFNAMLQHYPLFPVIAEDLGTIGAEVRETMARYAI
PGMKVLLLGFQKEAHEKSYLPHLHPRNSVAYTGTHDTATVTGWYHGADDKERQELFRYLG
RRAENGVNWELIRLALMSVAHTAVIQMQDVLGAGEESRMNKPGKAEGNWEWRVPPGDLGE
VASRLAEMTICYGRAQD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgcggtagcgggattctctgtcacatcacttccctcccctccccattcggc
ataggagactttggcgccggcgcctacgggttcgccgatttcctgtgcgaggcaaaacag
agctactggcagatcctgccgctcaaccccaccaacaagaggtatttcgactcccccttc
agctccctctcctcctgcgccgggaataccgccctaatcagccctgagttgctggcggcg
gaggggctcctgacgcagcaggaggtggaggaccgtccccgcttcccggaacaccgagtg
gattaccaggccgcttcgcgtttcaagcggcagcttttccagcgggcgcacacccgcttc
cagaagggaggcgtaccggaggactacgccaggttctgccggggcaactcgatgtggctt
gaggaccatgccctctttaccgcgctcagcaatcatctcggcaatgccccgctgaccgaa
tggccgcaggaactcatcaaccgcaacagcgagaaggtgcagctgctgcgtgaagagttc
tgggacgaggtagagctggagaaattcctgcagtacctcttcttcaagcagtggcacctg
ctgaagaactactgcaacggcaaggggatccggatcatcggcgacttccccatgttcatg
aactacgatgccgtggacatctggaccaatccggaactgttcaaggtcgatgagcggaaa
aagccttacgtcctcgccgggagcccccccgatgccttcagcgccgaagggcagctcttc
aactgcgcggtatacgactgggacgggctgaagcgtaacggtttcaactggtggatcagg
cgctttcactacctgttcaggcagtacgactttgtgaggatcgaccatttccgcggcctg
atctcctattgggaggtcccggcaggggagcaaaacgggctcaggggtagctggcagcaa
accccgacgcaggaattcttcaacgcaatgctgcagcactatcccctcttcccggtgatc
gccgaggacctggggaccatcggcgccgaggtcagggagaccatggcacggtacgctatc
cccgggatgaaggtgctcctcttggggttccagaaggaggcgcatgaaaagagctacctg
ccgcacctccacccccgcaacagcgtggcctacaccggcacccacgacaccgccaccgtc
acggggtggtaccatggcgccgacgataaggagcggcaagaactcttccgctatctgggg
cggcgggctgagaacggagtgaactgggaactgatccggctggcgctgatgtcggtagcg
catacggcggtgattcagatgcaggacgtcttaggggcgggcgaggaatcgaggatgaac
aaaccagggaaagcggaagggaattgggagtggagggtcccgccaggcgatcttggagag
gtcgcttcccgtctcgccgagatgacgatctgctacggacgggcgcaggattga

DBGET integrated database retrieval system