KEGG   Geobacter bemidjiensis: Gbem_0994Help
Entry
Gbem_0994         CDS       T00749                                 

Gene name
pcm-2
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Gbem_0994 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1150716..1151375
Genome map
AA seq 219 aa AA seqDB search
MTVDPKRAMEARKERMLSEHLAARGIRDAAVMQAMREVPREAFLPLGMELFAYDDGPLPI
AEGQTISQPYIVAYMIEALELLGRERVLEIGTGSGYAAAVLSRCAAQVYTVERIPSLAAG
ARARLKELGYGNVTVHLGDGTRGWLEHAPYDAIVVTAGAPEVPRELLDQLAPLGRLVIPV
GPTQHLQELVLVRRTRDGHFRHEQLCPVRFVPLIGEHGW
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgacccgaaaagagcgatggaggccaggaaggagcggatgttgagcgagcac
cttgccgcgcgggggattcgcgacgcggccgtaatgcaggcgatgcgggaggttcccaga
gaagcctttctccccttggggatggaactttttgcctacgacgacggtccgctccccata
gcggaggggcagaccatctcgcagccctacatcgtcgcctacatgattgaggcgctcgag
ttgctgggcagggagcgggtgctcgagatcggcaccggttcaggctatgccgcggcggtt
cttagccgttgcgccgcccaggtctacacggtggagcgcatcccctccctggccgcgggg
gcgcgggcgaggctcaaagagcttggctacggcaacgtcaccgtccatctcggagacggc
acacgggggtggctggaacacgcgccctacgacgccattgtggtgactgcgggggcgccc
gaggtgccgcgcgagttgctggaccagctggcgcccttggggagactggtgataccggtc
ggccccacccagcacctgcaggagctggtgctggtgcgccggacgcgtgacgggcatttc
cgccatgagcagctctgcccggttcgcttcgtgccgctgatcggcgagcacggctggtga

DBGET integrated database retrieval system