KEGG   Geobacter bemidjiensis: Gbem_0994Help
Entry
Gbem_0994         CDS       T00749                                 

Gene name
pcm-2
Definition
(GenBank) protein L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Gbem_0994 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 RrnaAD Methyltransf_12 Methyltransf_32 GCD14 Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: ACH38015
JGI: Gbem0994
UniProt: B5EGF0
Position
1150716..1151375
Genome map
AA seq 219 aa AA seqDB search
MTVDPKRAMEARKERMLSEHLAARGIRDAAVMQAMREVPREAFLPLGMELFAYDDGPLPI
AEGQTISQPYIVAYMIEALELLGRERVLEIGTGSGYAAAVLSRCAAQVYTVERIPSLAAG
ARARLKELGYGNVTVHLGDGTRGWLEHAPYDAIVVTAGAPEVPRELLDQLAPLGRLVIPV
GPTQHLQELVLVRRTRDGHFRHEQLCPVRFVPLIGEHGW
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgacccgaaaagagcgatggaggccaggaaggagcggatgttgagcgagcac
cttgccgcgcgggggattcgcgacgcggccgtaatgcaggcgatgcgggaggttcccaga
gaagcctttctccccttggggatggaactttttgcctacgacgacggtccgctccccata
gcggaggggcagaccatctcgcagccctacatcgtcgcctacatgattgaggcgctcgag
ttgctgggcagggagcgggtgctcgagatcggcaccggttcaggctatgccgcggcggtt
cttagccgttgcgccgcccaggtctacacggtggagcgcatcccctccctggccgcgggg
gcgcgggcgaggctcaaagagcttggctacggcaacgtcaccgtccatctcggagacggc
acacgggggtggctggaacacgcgccctacgacgccattgtggtgactgcgggggcgccc
gaggtgccgcgcgagttgctggaccagctggcgcccttggggagactggtgataccggtc
ggccccacccagcacctgcaggagctggtgctggtgcgccggacgcgtgacgggcatttc
cgccatgagcagctctgcccggttcgcttcgtgccgctgatcggcgagcacggctggtga

DBGET integrated database retrieval system