KEGG   Geobacter bemidjiensis: Gbem_1014Help
Entry
Gbem_1014         CDS       T00749                                 

Gene name
malQ-1
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gbm  Geobacter bemidjiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbem_1014 (malQ-1)
Enzymes [BR:gbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Gbem_1014 (malQ-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1171929..1173413
Genome map
AA seq 494 aa AA seqDB search
MRQRKSGVLLHPSSLPGAGGIGSFGEEARRFVDFLHKSGQSLWQILPLGPTAYGNSPYSC
YSAFAGNPLLVNLEAVQDDGDLLPQENKPDLSTDRIDFPTVEEHKLGRLRGAAARFFAEA
TQKRKEEFWQFCDGTFWLHDFALFMALKEEFKGVSWKDWPDTLANREPAALSFWSEKLGT
AIGEQKYQQWQFARQWKKLKSYANVLGISVVGDLPIFVAYDSADVWANPHLFHLDEKGVP
IVVAGVPPDYFSKTGQLWGNPLYNWEQMAQEGYGWWIARLRNDLCLYDMVRIDHFRGFEA
FWEVPMWEKTAINGRWVKGPGEALFHALRNALGNLPIIAEDLGIITPEVEALREQFGFPG
MKILQFAFGSGPENPYLPHNHVRSCVVYTGTHDNDTTAGWFDTLKTKEQKNVLAYFDRDG
GDIVWQMVKCALASVADYAIIPMQDLLELPSTGRMNVPGVAGGNWSWRCPADAFSGRLAA
KLARATELYGRLPD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgagacagagaaagagtggggtactgttgcaccccagctcgttgccaggagccggaggc
ataggttcatttggcgaagaagcgcggcgtttcgttgactttctgcacaagtccggtcag
tctctctggcaaatccttccccttggccctaccgcctatggaaactccccatattcctgt
tactcggcttttgccggtaacccccttctggtcaacctggaagcagtccaggacgatggg
gatctattgccccaggaaaataagcccgatctttccaccgaccggatagattttccgacg
gtcgaagagcacaagctggggcgcttgaggggggcggcggcgcgttttttcgcggaggcg
acgcaaaagcgcaaagaggagttctggcagttctgcgatggcaccttctggctgcacgat
ttcgcgctcttcatggcgctgaaggaagagttcaagggcgttagctggaaggattggccg
gatacgctggctaaccgggagcctgctgcactttccttctggagcgagaaattaggtacc
gccatcggcgagcagaagtaccagcagtggcagttcgctcggcaatggaagaagttaaag
agctatgcgaacgtcctcggcatctcggtggtcggtgacctgccgatcttcgtcgcctac
gattccgcggatgtatgggcaaatccgcaccttttccacctggatgagaagggggtcccc
atcgtagtggcaggggtgccgccggattacttcagcaagaccgggcagctctgggggaat
ccgctctataactgggaacagatggcccaggaagggtacggctggtggatcgccaggctg
agaaacgacctttgcctctacgacatggtgcgcatcgatcacttccgcggcttcgaggct
ttctgggaagtgccgatgtgggagaagaccgcgatcaacggccggtgggtgaaagggccg
ggtgaggcattgttccatgccttgcgcaacgcgttgggaaatctccccatcatcgccgag
gacctcggcatcattacgccggaggtggaagctctcagggaacaattcggcttccccggc
atgaagattctgcagttcgccttcggatccggccccgaaaatccatatctgccgcacaac
catgtgcgctcctgcgtggtctataccgggactcacgacaacgataccacagcagggtgg
ttcgatactctgaagacgaaggagcaaaagaacgtgctggcttattttgatcgggacgga
ggcgacatcgtctggcagatggtgaaatgcgccctcgcctcagttgccgactatgccatc
atccccatgcaggacctgctggaactgcccagcaccggccggatgaacgttccgggtgtc
gccggaggcaactggagctggcgatgccccgccgacgccttttccggaaggcttgccgcc
aaactcgcacgggctaccgaactttacggcaggttgccagactaa

DBGET integrated database retrieval system