KEGG   Geobacter bemidjiensis: Gbem_1041Help
Entry
Gbem_1041         CDS       T00749                                 

Gene name
cheB-6
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gbm  Geobacter bemidjiensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gbm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gbm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1213540..1214631)
Genome map
AA seq 363 aa AA seqDB search
MAIKVLIVDDSALIRSLLTEIINAEPDLQVVGTAPDPLAARQRIKELNPDVLTLDVEMPK
MDGLVFLEKLMRLRPMPVVMVSSLTEKSSAVTLKALEMGAFDFVTKPKIDIRSGIMEYAG
ELTEKIRCAYLSGRRRKGARGGELQPVTGKLSADAILPNRRDHFSSTEKVIAVGASTGGT
EALKTFLAALPPDCPGILVTQHMPETFTKTFAARLNGLCQLAVKEAEHGERVLPGHAYVA
PGNRHLMLARSGANYTVALGDGPAVSRHRPSVDVLFRSAANCAGANSLGIIMTGMGDDGA
AGMLEMHAAGARTIAQDEESCVVFGMPKEAIARGGVDEVVPLEEIAGRLIAWLASHGRRS
FRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaaggttctcatagtagacgattccgcactgatacgctcgctgctcaccgag
atcatcaacgccgagccggacctgcaggtggtcggcacggcgcccgacccgctggcggcg
cggcagcggatcaaggagctgaacccggacgtactgaccctggacgtggagatgccgaag
atggacgggctcgtcttcctggaaaagctgatgcggctgcgccccatgccggtggtcatg
gtctcctcgctcaccgaaaagagctcggcggtgacgctcaaggcgctggagatgggagcc
ttcgatttcgtgaccaagccgaagatcgacatccgcagcgggatcatggagtacgccggc
gagctgaccgagaagatccgctgcgcctatctctccgggcgcaggaggaaaggggcgcgg
ggaggagagctccaacccgtcaccgggaagctttccgccgacgcgatcctccccaaccgg
cgggaccacttctcctccacggagaaggtgatcgcggtcggagcctccaccggcgggacc
gaggcgctgaagaccttcctcgccgcgctccccccagactgcccggggatactggtgacc
cagcacatgccggagaccttcaccaagacctttgcggcgcgcctgaacgggctttgccaa
ctggcggtgaaggaggcggagcacggggagcgtgtgctgccggggcatgcctacgtggca
cccggcaaccgccacctgatgctggccagaagcggcgccaactacaccgtggcgctgggg
gacggccctgcggtctcccggcaccgcccctcggtggacgtgctctttcgctccgcggcc
aactgcgccggcgccaacagcctgggaataatcatgaccggcatgggggacgacggcgcc
gccgggatgctggagatgcacgcggcgggggcgagaaccatcgcccaggacgaagagagc
tgcgtcgtcttcggtatgccgaaggaggcgatcgcccgcggcggcgtcgacgaagtggtg
ccgcttgaggagatcgcggggcggctcatcgcctggcttgcctcgcacggcaggagaagt
ttcagggtgtag

DBGET integrated database retrieval system