KEGG   Geobacter bemidjiensis: Gbem_1081Help
Entry
Gbem_1081         CDS       T00749                                 

Gene name
asnB-3
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbm  Geobacter bemidjiensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbem_1081 (asnB-3)
Enzymes [BR:gbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Gbem_1081 (asnB-3)
Peptidases [BR:gbm01002]
 Cysteine Peptidases
  Family C44
   Gbem_1081 (asnB-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1256307..1258289
Genome map
AA seq 660 aa AA seqDB search
MCGIAGIVAGAGKAAPDLERIVAMISPLRYRGPDESGVYLDRRAALGHLRLSIIGIDGGI
QPIGNETGKLWIVYNGEAYNYLELREELEAKGHRFTTRTDTEVLLHLYEEYGADFLSRIN
GQFALAIWDSAKEELFLARDRVGIRPLYYGWSREGSFLFASEVKAILAVDGSRELDLEAL
GQLFVFWTTLPGRTFFRGIQEVPPGHYLVVGKGESVPRPYWRIPFHAPEECCAFGLAETA
EALRELLSDAVRLRLRSDVPVGAYLSGGLDSSVITTLIQRHCDSHLKTFSLAFQDGIFDE
SAAQREMVRFLGSDNRQVMVENGDIRRFFPETVWHCEKPTLRTSPVPMFLLSRLVREEGY
KVVLSGEGADEILGGYNIFKEAKIRQYWAKCPDSSRRPLLLERLYPYIFRNPGRGRSFLQ
GFFAVSREQMHDPFFSHAVRWHAGERNLAFLAPDCLAALSQYRPMEELARWLPDNFLHRD
LLSRAQVLEMEIFLSNFLLSSQGDRVAMAHSVEMRHPFLDYRVVDFAFRLPAKWKVRGLT
EKFLLRHAFRGMLPEGIASRAKHPYRAPISELFQGTVPLDYVDELLSQQSLKQSGYFNAE
KIGRLYLKVKGAQPGAIGEFENMALIGALSTEILHRQFIAGFPLRRSSLLQPDLVRYGSL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcggtatcgccggaattgttgctggggcgggtaaagcggcaccggacctggagcgg
atcgtcgccatgatctcgccgttgcgttatcgcggcccggacgagtccggtgtctatctg
gaccgccgcgccgcgctggggcacctgcgcctgagcattatcggcatagacggcgggatc
cagcccatcggcaatgaaacgggcaagctctggatcgtctacaacggcgaagcatacaac
tacctggaacttcgggaagagctggaggcgaaagggcatcgcttcaccacccggaccgac
actgaagtgctgctgcacctctacgaagagtatggcgccgacttcctgtccaggatcaac
ggccagttcgcactcgccatatgggacagcgcgaaagaggaactcttcctcgccagggac
cgggtcggcatcaggcccctttactacggttggtctcgcgaagggagcttcttgttcgcc
tctgaggtgaaagccattttggcagtagacggtagccgggagttggacctcgaggctctt
ggacagctcttcgtcttctggaccacgctgccgggaaggaccttcttccgggggattcag
gaagttcccccggggcattaccttgtcgtcggcaaaggtgagtcggtgccgcgcccctac
tggcgcattccgttccatgctcccgaggagtgctgcgctttcggccttgcggagacggct
gaagcgctgcgggagcttctcagcgacgcggtgcgcctcaggctgcgctcagacgtcccg
gtgggggcgtacctaagcggcgggctcgattcttccgtgattacaacgctcattcagcgc
cattgcgacagccatctcaagaccttctcgcttgccttccaggacggcatttttgacgag
agcgctgcgcagcgggagatggtgcgtttcctggggagcgacaaccggcaggttatggtg
gagaacggcgacatccgccgcttctttccggagacggtatggcactgtgaaaagccgacg
ctgcgaacctcgccggtgcctatgttcctgctgtcgaggctggtgcgtgaggagggttac
aaggtggtgctctccggcgagggggcggacgagatcctcggggggtacaacatcttcaag
gaagcgaaaatccgccagtactgggcgaaatgcccggactcttcccggcgcccgctgctt
ttggagaggctctacccttacatcttcaggaaccccgggcgcggccgtagcttcctgcag
gggtttttcgctgtgtcgcgggagcagatgcacgacccgtttttttcccatgcggtgcgt
tggcacgccggggagcgcaacctcgcgttcttggcgccggactgcctggccgccctgtcg
caataccggcccatggaggaactggcccggtggctcccggacaatttcctgcaccgggac
cttttgtcccgggcccaagtgctggagatggagatctttctctccaacttccttctctcc
tcacaaggagaccgggtcgccatggcccactcggtcgagatgcgtcacccctttctggat
taccgggtggtggatttcgctttccgtctgccggccaaatggaaggtgcggggcctgact
gagaagttcctgctaaggcacgccttccggggaatgttgccagaaggaatcgccagcagg
gcgaagcacccgtaccgggccccgatcagcgagctcttccaaggcacggttcctctcgat
tacgtggacgagttgctgtcgcagcagagcctgaagcaaagcggttatttcaatgctgaa
aagatcggccgcctctacttgaaggtcaagggtgcgcaacccggcgccatcggcgaattc
gagaacatggcgctcatcggcgcactttcaaccgagatactgcatcggcagttcattgcc
gggtttcccttgcggcggagctccttgctgcaaccggacttggtacggtacgggagcctc
tga

DBGET integrated database retrieval system