KEGG   Geobacter bemidjiensis: Gbem_1204Help
Entry
Gbem_1204         CDS       T00749                                 

Gene name
rph
Definition
ribonuclease PH
Orthology
K00989  
ribonuclease PH [EC:2.7.7.56]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     Gbem_1204 (rph)
Transfer RNA biogenesis [BR:gbm03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Gbem_1204 (rph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1398492..1399211
Genome map
AA seq 239 aa AA seqDB search
MIRREGRAANALREVKITRNYLKHAEGSVLVEFGDTKVICNATVEARVPSFLKGKGSGWV
TAEYCMLPRATHTRNQRESAKGKLSGRTHEIQRLIGRSLRAVVDLELLGERSIVIDCDVI
QADGGTRTASITGAYVALADALQNLVNAGELEKSPLREAVAAVSVGIVDGVPFLDLDYPE
DSTAEVDMNFVMTSSMRFVEVQGTAEAEPFTLDQMDAMRRHAMLGLSRLFEIQQEALQA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcagagaaggccgcgcggccaacgccttgagagaagttaagatcacccgcaat
tacctgaagcacgccgagggctctgtcctggtcgagtttggggacaccaaagtcatctgc
aacgcaacggtcgaggcgagggtaccttcgtttctgaaagggaaggggagcggctgggtc
acggcggagtactgcatgctgccgcgcgccacgcacaccaggaaccagcgcgaatctgcc
aaggggaaactctccggccgcacccacgagatccagaggctgatcggcaggtcgctgcgc
gcggtggtcgacctggagcttctgggcgagcgctccatcgtgatcgactgcgacgtgatc
caggccgacggcggcacccgcaccgcctccatcaccggcgcctacgtggccttggcggac
gcgctgcagaacctggtcaacgccggcgaactcgagaagagccccctcagggaggcggtc
gccgccgtaagcgtggggatcgtcgacggcgttcccttcctcgacctcgactaccccgag
gactccaccgccgaagtcgacatgaacttcgtgatgacctcgtccatgcgctttgtcgag
gtgcaggggactgccgaggcggagcctttcaccctcgaccagatggacgccatgcgcagg
cacgcgatgctcggcctctcccgcctcttcgagatccagcaggaggctttgcaggcatga

DBGET integrated database retrieval system