KEGG   Geobacter bemidjiensis: Gbem_1221Help
Entry
Gbem_1221         CDS       T00749                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gbm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1414186..1416381
Genome map
AA seq 731 aa AA seqDB search
MKETPPTENVDRLSGSLERVTFHSEETGFCVLRVKVAGQRDLVTVTGAAASVTPGEYLEC
TGSWHNDRTHGMQFKAGHIKVVPPTTLEGIEKYLGSGMVHGIGAHFAKVLVKSFGAAVFD
VIENHPERLLELPGIGRKRMESVAGAWVEQKAIRDIMVFLQSNGLGTARAVRIYKSYGNE
AIFKVTENPYRLALEIHGIGFKTADLLAAKLGIAPDSMIRAQAGVRHVLQEMSAGGHCAS
LRAELAESAATLLEIPQPVIESAIEAELAEENLVADQISGSPCVFLAPLYKAEVGVASGI
CRLRAGTPPWGGIVAEEAIPWVESQKGITLSASQRDAIRLALKSKVVVVTGGPGVGKTTL
VNSILGVIGRRPLRVTLCAPTGRAAKRLAESTGMEAKTIHRLLEFDPQTFGFKRCKENPL
HTDLLVMDEASMVDVVLMNKLLPAIPDHAGLIIVGDVDQLPSVGPGCVLSDIIESGAVPT
VRLTEIFRQAAGSRIIVNAHRINRGELPLKDEGKELADFYFIPAATPEDIHDKLLQVVRE
RIPKRFGFDPVREVQVLTPMNRGGLGTRSLNAELQGVLNGRAEPKVERFGTSYAPGDKVI
QTVNNYEKEVFNGDIGRIVEIRSEESALIVDFDDRLVEYAFAELDEVSLAYATSIHKSQG
SEYTAVVIPLAMQHYTMLERNLLYTAVTRGKKLVVVIGEQKALAMAVQNQKSHRRLTKLA
GRIGQKGDGIT
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagacacccccaacagaaaacgtcgacaggctctccggatcgctggagcgcgtc
acctttcacagcgaggagaccgggttttgcgtgctgcgggtgaaggttgccgggcagcgc
gacctggtgacggtgacgggcgccgcggcctcggttacgccgggggagtaccttgagtgc
accggctcctggcacaacgaccggacccacggcatgcagttcaaggccgggcacatcaag
gtggttccccccaccacgctggaagggatcgagaagtacctgggtagcggcatggtgcac
ggcatcggggcccacttcgccaaggtgctggtgaaatcgttcggcgcggcggtcttcgac
gtcatagagaaccacccggagaggctcctggaactcccggggatcggccgcaagcggatg
gaatcggtcgccggcgcctgggtggagcagaaggcgatccgggacatcatggtgttcctg
cagtccaatggccttggaaccgcccgcgccgtgaggatctacaagagctacggcaacgaa
gcgatcttcaaggtgaccgaaaacccgtaccggctggccctggagatccatggcataggt
ttcaagactgccgacctcctggctgccaagctggggatagcgcccgattccatgatccgg
gcccaggcgggggtgcggcacgtgctgcaggagatgtcggccggcgggcactgcgccagc
ctgcgggcggaactggccgagagcgcagctactctgctggagatccctcaaccggtaatc
gaatccgccatcgaggcggaactcgccgaggagaacctggtcgccgaccagatctccggc
tccccctgcgtcttcctggcgccgctctacaaggcggaggtaggcgtagcctccggcatt
tgccggcttcgcgccggcacgcccccttggggcggcatcgtcgccgaagaggcgatcccg
tgggtggagagccaaaaaggaatcaccctttccgcctcgcagcgcgatgcgattcggctc
gcgcttaagagcaaggtggtcgtggtgaccggcggaccgggggtgggtaagaccacgctg
gtcaacagcatcctgggtgtcatcggcagaaggccgctccgggtcaccctctgcgcgccg
acggggagggcagccaagcgcctcgccgaatcgaccgggatggaggcgaagaccatccat
cggctcttggagttcgacccgcagaccttcggcttcaagcgctgcaaggagaacccgctt
cacaccgacctcctggtcatggacgaggcgtccatggtcgacgtcgtgttgatgaacaag
ctccttcccgccattcccgaccatgccggcctcatcatcgtgggggacgtggaccagctc
ccctcggtggggccaggctgcgtcctctccgacatcatcgagtccggcgcggttccgacg
gtacggctcaccgagatcttccggcaggccgcaggctccaggatcatcgtcaacgcccac
cgcatcaaccggggtgagctgccgctgaaggacgaggggaaggagctcgccgacttctac
ttcatcccggcggcgacgcccgaggatatccacgacaagctcctgcaggtggtcagggag
cggatacccaagcgcttcggcttcgatccggtgcgcgaggtccaggtgcttacgccgatg
aaccgcggggggctcgggaccaggtccctcaacgccgagttgcagggggtgctgaacggc
agggccgagccgaaggtggagcgcttcggcaccagctacgcccccggggacaaggtgatc
cagacggtgaacaactacgagaaggaggtcttcaacggggacatcggacgcatagtcgag
atccgctccgaagaaagcgccctcatcgtggacttcgatgaccggctggtggaatatgca
ttcgccgaactggacgaggtgagccttgcctacgccaccagcatccacaagagccagggg
tccgagtacacggccgtggtgatcccgcttgccatgcagcactacaccatgctggagcga
aacctcctgtacaccgccgtcacccgcggcaagaagctcgtggtggtgatcggcgagcag
aaggcgctcgccatggcggtgcaaaaccagaagtcccaccgccgcctgaccaagctggcg
gggaggatcggacagaaaggagacgggataacatga

DBGET integrated database retrieval system