KEGG   Geobacter bemidjiensis: Gbem_1298Help
Entry
Gbem_1298         CDS       T00749                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbem_1298 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_1298 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gbem_1298 (thrC)
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gbem_1298 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1499588..1500964)
Genome map
AA seq 458 aa AA seqDB search
MKYISTRGKIAPVGFKDAVMMGLATDGGLILPESIPQLDRGTLAAWSKLPYRELAFNVIS
LFATDIPAFDLKALIDRSYGSFEHEETTPLVQKDGVYILELFHGPTLAFKDVALQLLGNL
FEYLLKERGEKMNILGATSGDTGSAAIAGVRGKENINIFILHPHLKTSPIQALQMTSVLD
ENVHNVAVEGTFDDCQNIVKALFNDLQFKKEYALGAVNSINWARVLAQVVYYFYAWGRLP
EQKEVIFSVPTGNFGDIFAGYLAKRMGLPVEKLLLATNENNILARFVQTGDYSLGKVVQT
VSPSMDIQLASNLERYLYYLWDENPEKVCSAFAELQSTGRIVFTKEQVLRVQAEFMSCTV
DEQKTLDTIASFNRETGYLLDPHTAVGVRGALECAPGHPRVVCLATAHPAKFGDAVERAV
GSPPPLPPALAALVGKETRCELMAPDREKIKAFVKAKA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacataagcaccaggggaaagatagcgccggtcggtttcaaggacgcggtcatg
atgggacttgccaccgacggcgggctgattcttccggaatcaatcccgcagctcgaccgc
ggcaccttggccgcctggtccaagctcccctaccgcgagcttgccttcaacgtcatctcc
cttttcgccaccgacataccggctttcgacctgaaggcgctcatcgaccgttcctacggc
agcttcgagcacgaggagaccacgccgctggtgcaaaaggacggcgtctacatattggag
ctcttccacggccccaccctcgccttcaaggacgtggcgctgcagcttcttgggaacctc
ttcgaataccttttgaaggagcgcggggagaagatgaacatcctcggcgccacctcgggc
gacaccgggagcgcggccattgccggggtgcgcggcaaggagaacatcaacatcttcatc
ctgcatccgcacctgaagacctcgccgatccaggcgctgcagatgaccagcgtactcgac
gagaacgtgcacaacgtcgcggtggaggggaccttcgacgactgccagaacatcgtgaag
gccctcttcaacgacctgcagttcaagaaggagtacgcgctcggcgcggtgaactcgatc
aactgggcgcgcgttttggcccaggtggtctactacttctacgcctggggtaggctcccg
gagcaaaaagaggtgatcttctccgtccccaccggcaacttcggcgacatcttcgccggc
tacctcgcgaaaaggatggggctcccggtggagaagctgcttttggccaccaacgagaac
aacatcctcgcccgcttcgtgcaaaccggcgactattcgctcgggaaggtggtgcagacc
gtctccccctccatggacatccagctcgcctccaaccttgagcgctacctctactacctc
tgggacgagaacccggagaaggtctgcagcgccttcgccgaattgcagtcgaccggcagg
atcgtgttcaccaaggagcaggtgctaagggtgcaggcggagttcatgagctgcacggtg
gacgagcagaagaccctggataccatcgcctccttcaaccgcgaaaccggctacctcctc
gacccacacaccgcggtcggcgtgcgcggcgccctggaatgcgcgccgggtcacccgagg
gtggtctgcctcgccacggcacacccggcgaaattcggggatgccgtcgagcgcgccgta
ggctcacctcccccgcttcccccggcactcgcggccctggtgggtaaagagacccgctgc
gagctgatggcgcccgaccgggagaagatcaaggcgttcgtcaaggccaaggcgtaa

DBGET integrated database retrieval system