KEGG   Geobacter bemidjiensis: Gbem_1326Help
Entry
Gbem_1326         CDS       T00749                                 

Definition
ROK domain transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_1326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_1326
   00052 Galactose metabolism
    Gbem_1326
   00500 Starch and sucrose metabolism
    Gbem_1326
   00520 Amino sugar and nucleotide sugar metabolism
    Gbem_1326
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gbem_1326
   00524 Butirosin and neomycin biosynthesis
    Gbem_1326
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gbem_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1529992..1530912
Genome map
AA seq 306 aa AA seqDB search
MESVCIGVDVGGTNLRFALVDQGGAVLSRVSEPTETVTAPAPFVARLQGRVQQLQREALA
RGVRVAGVGIGVAGLVSGEGAVLSSVNLPALQGVNLGAELSRALGVPVLVLNDANACAVG
EQRFGAGKGYRSWLMLTIGTGVGAGLILDGRLWTGANGLAGELGHLTVEPEGRPCGCGNR
GCLEQYTFATAISAGNDSAAAVARRAVSGDAAAVARFEGAGRYLGIAVAGVLNLLNLEAV
VLGGGVSESFELLAPAMRREICSRTLALPGAAACVVKGALGPDAGVLGAAQAAFDAEKIS
SRSHLS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgtctgtatcggggtggacgtcggggggactaaccttcgcttcgccctggtg
gaccaaggcggcgcggtgcttagcagggtgagcgaaccgacggagacggtgacggctccc
gcgccgtttgtagcccggctgcaggggagggtgcaacagctgcaaagggaggcgctggcc
cggggagtcagggtcgccggcgtcggcatcggtgtcgccggtctcgtctcgggtgaaggt
gcggtcctttccagcgtcaacctcccggcgctgcagggggtaaacctcggcgcggagctt
tcgcgcgccctgggggtgccggtgctggtgctaaacgacgccaacgcctgcgccgtcggc
gagcagcgcttcggcgcgggaaaagggtaccgctcctggctcatgctcaccatcggcacg
ggggtgggggcggggctgatacttgacggccggctctggaccggggcgaacgggctggcc
ggcgaattggggcacctgacggtggaaccggaggggcgcccgtgcggctgcggcaaccgg
gggtgcctggagcagtacacctttgccaccgccatttccgcgggaaacgacagcgccgct
gccgtcgcccggcgcgcggtgagcggggacgccgcggctgtcgcccgttttgagggggct
ggccgctacttgggcatcgccgtggccggggtgctcaacctgctgaacctggaagcggta
gtgctgggaggaggggtgtcagagagtttcgagctactggccccggcgatgcgccgggag
atatgctcccgcacccttgcgcttcccggggcggccgcctgcgtcgtcaagggcgccctc
ggcccggacgccggtgtcctgggtgctgcccaagccgccttcgacgccgaaaaaatttcc
tcgcgctcccacctttcctga

DBGET integrated database retrieval system