KEGG   Geobacter bemidjiensis: Gbem_1327Help
Entry
Gbem_1327         CDS       T00749                                 

Definition
protein disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Gbem_1327
Secretion system [BR:gbm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Gbem_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1530975..1531703
Genome map
AA seq 242 aa AA seqDB search
MWFTRRILAACLSAAVLLLLAGVSFAAPISPENAFRSAFPQVPFDSMTPTEIKGVYEVVS
GPNIFYYYPEKDLILTGEIVGKDLKSRTAERKQALSSQVAAKAMEAVKELPLDKAVKVGD
GKKTVIEFTDPDCPYCRKASEYFTKRSDVTRYVFFAPLAHPAAIKKIEYILSAENKAEAY
DAMMLGEEIPASAKPASAEVKKLAQEHLALARKVGIQGTPTFFVKGEQVIGADTKKLDEL
LK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttactcggagaatcctggcagcttgtttgtccgcagcggtgctgcttcttctg
gcaggtgtgtcgttcgccgccccgatctcccctgaaaacgcctttcgcagcgcgttcccc
caggtccccttcgacagtatgacccccacagagatcaagggtgtgtacgaggtcgtttcc
gggcccaacatcttctactactacccggagaaggatctcatcctcaccggcgagatcgtg
gggaaggacctcaagagccgtacggcggagcggaagcaggcgctcagctcgcaggtggcg
gccaaggcgatggaagcggtcaaggagctgccgctcgacaaggcggtcaaggtgggggac
ggcaagaagacggtcatcgagttcaccgaccccgactgcccgtactgcaggaaggcttcc
gagtacttcaccaagagaagcgacgtgaccaggtacgtcttcttcgcgccgctggcgcac
ccggcggccatcaagaagatcgagtacatcctttccgccgagaacaaggccgaggcctat
gacgccatgatgctgggcgaggagattccggcctccgccaagccggcgagcgccgaggtg
aagaagctggcccaggagcacctcgcactggcgagaaaggtgggtatccaggggaccccg
accttcttcgtcaagggggagcaggtcatcggcgccgacaccaagaagctggatgagctt
ttgaaataa

DBGET integrated database retrieval system