KEGG   Geobacter bemidjiensis: Gbem_1444Help
Entry
Gbem_1444         CDS       T00749                                 

Gene name
bamB-1
Definition
(GenBank) benzoyl-CoA reductase, putative
  KO
K19515  
benzoyl-CoA reductase subunit BamB [EC:1.3.-.-]
Organism
gbm  Geobacter bemidjiensis
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Module
Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbem_1444 (bamB-1)
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.-  Acting on the CH-CH group of donors
    1.3.-.-  
     Gbem_1444 (bamB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1667335..1669353
Genome map
AA seq 672 aa AA seqDB search
MRYAETGYVLEVDLTKGNIERVATDPKDTELYLGGLGTNAKLLWDRVPADVDAFSPENLL
IFAAGLLCGTPATGCNRTIVSTISPQTKLMAFSMMGGFWAPELKYAGYDKVVLRGKSPKL
VYLYINNDKVEIRDASHLKGKGAIETAELIKKELNEPRAQVAAIGLAGENRVFYASIEQG
RSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPEEFNNLCGEVLDYIKHREDNPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTDEVSHAWEETMDKARTRLISCF
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAFSDLDFGLRMAQKATEYGLDGFSTPQVM
AFAMELLEKGILKQSDFPGMPDENDAKFFYLLDLIVNRQGIGDILAEGTYWAAKKIGNGA
EEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPKVEQREEFVK
DWVQVPDDKFKDIFLQWEPRGEKSMPNFPTVDMCCDIVDWQEMMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFISAGAGIEMDKDKLTKAAKRYRTLVRAINIRRGMRRVDEQPPANHW
KNRFPELEKDLLDSYYKLKGWNDDGIPTKETLEELGLGYVAREFEKTGVYDGKPAVTAAA
TQETLLSGGVQP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgcagagacaggatacgtgctggaagtcgacctgaccaaggggaacatcgag
agggtggctaccgatcccaaggacaccgagctttacttgggcggcctgggaaccaacgcc
aagctgctgtgggaccgggtcccggctgacgtcgacgccttttctccggaaaaccttctc
attttcgccgccggccttctgtgcggaacgccggccaccgggtgcaaccgcaccatagtc
tccaccatctccccgcagacgaagctcatggccttctcgatgatgggcgggttctgggct
ccggagttgaagtacgcgggttacgacaaggtggtcctgcgcggcaagtcgccgaagctc
gtctatctctacatcaacaacgacaaggtcgagatccgcgacgcctcccacctgaaaggg
aagggggccatcgagaccgccgagctcatcaagaaggagctgaacgagccgagagcccag
gtggccgccattggcctcgccggcgagaaccgggtcttctacgcctccatcgagcagggc
agatcctccgcctcccgcggcggcatcggcgcggtgatgggggacaagggggtcaaggct
gtggtcgttcgcggcaccaaggacctctgcgtcgccaagcccgaggagttcaacaacctc
tgcggcgaggtgctcgactacatcaagcaccgcgaggacaacccgatccccgacgtgatg
cccatcctggccgggctcgggagcccgcaggagatgaaggtccacgacgagaagtggcac
accgagaacttcaactggggcaacgcccgtacccgccgcaaggacttctggaccgacgag
gtgagccacgcctgggaagagaccatggataaggcgaggacccgcctcatcagctgcttc
aactgtcccatgaagtgcggcgccaccatctccatggaggggctccccacctacatgatg
aagtgcttcaccaagctcacctacaccatggcggccttctccgacctcgactttggcctg
aggatggcgcagaaggcgaccgagtacggcctggacggcttctcgaccccgcaggtgatg
gccttcgcgatggagcttttggagaaggggatactgaagcagagcgacttccccggcatg
cccgatgagaacgacgcgaagttcttctacctcctggacctgatcgtgaaccgccagggg
atcggcgacatcctggccgaggggacctactgggccgcgaagaagatcggcaacggcgcc
gaggagtacgcccacaacaacatcaagaagcacgagcagctccccttgaagctctccatg
ctgaaccccatctactacctgatgtactgcaccggggagaagatcaacatcacccagatc
gaggggcagttcccgcaggcgccgtacccgaaagtggagcagcgcgaggagttcgtgaag
gactgggtccaggttcccgacgacaagttcaaggacatcttcctgcagtgggagccgcgc
ggcgagaagtcgatgcccaacttcccgacggtcgacatgtgctgcgacatcgtggactgg
caggagatgatgcactacatcgacgacgcgctggggcagtgcgcggggctttcctccttc
ccgctgaagccgccgtaccacatccacaactacccgaaattcatctccgccggcgccggc
atcgagatggacaaggacaagctcaccaaggccgccaagcgctaccgtaccctggtgcgt
gccatcaacatccgccgcggcatgagaagggtcgacgagcagccgccggcgaaccactgg
aagaaccggttcccggaactggagaaggatcttctcgattcctactacaagctcaagggg
tggaacgacgacggcatcccgaccaaggagaccctggaggagctggggcttggctacgtg
gcgagggagttcgagaagaccggcgtctatgacggcaagccggccgtaaccgccgcggcc
acgcaggagacacttttaagtggaggggtacagccgtga

DBGET integrated database retrieval system