KEGG   Geobacter bemidjiensis: Gbem_1444Help
Entry
Gbem_1444         CDS       T00749                                 

Gene name
bamB-1
Definition
benzoyl-CoA reductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_1444 (bamB-1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gbem_1444 (bamB-1)
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Gbem_1444 (bamB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1667335..1669353
Genome map
AA seq 672 aa AA seqDB search
MRYAETGYVLEVDLTKGNIERVATDPKDTELYLGGLGTNAKLLWDRVPADVDAFSPENLL
IFAAGLLCGTPATGCNRTIVSTISPQTKLMAFSMMGGFWAPELKYAGYDKVVLRGKSPKL
VYLYINNDKVEIRDASHLKGKGAIETAELIKKELNEPRAQVAAIGLAGENRVFYASIEQG
RSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPEEFNNLCGEVLDYIKHREDNPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTDEVSHAWEETMDKARTRLISCF
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAFSDLDFGLRMAQKATEYGLDGFSTPQVM
AFAMELLEKGILKQSDFPGMPDENDAKFFYLLDLIVNRQGIGDILAEGTYWAAKKIGNGA
EEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPKVEQREEFVK
DWVQVPDDKFKDIFLQWEPRGEKSMPNFPTVDMCCDIVDWQEMMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFISAGAGIEMDKDKLTKAAKRYRTLVRAINIRRGMRRVDEQPPANHW
KNRFPELEKDLLDSYYKLKGWNDDGIPTKETLEELGLGYVAREFEKTGVYDGKPAVTAAA
TQETLLSGGVQP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgcagagacaggatacgtgctggaagtcgacctgaccaaggggaacatcgag
agggtggctaccgatcccaaggacaccgagctttacttgggcggcctgggaaccaacgcc
aagctgctgtgggaccgggtcccggctgacgtcgacgccttttctccggaaaaccttctc
attttcgccgccggccttctgtgcggaacgccggccaccgggtgcaaccgcaccatagtc
tccaccatctccccgcagacgaagctcatggccttctcgatgatgggcgggttctgggct
ccggagttgaagtacgcgggttacgacaaggtggtcctgcgcggcaagtcgccgaagctc
gtctatctctacatcaacaacgacaaggtcgagatccgcgacgcctcccacctgaaaggg
aagggggccatcgagaccgccgagctcatcaagaaggagctgaacgagccgagagcccag
gtggccgccattggcctcgccggcgagaaccgggtcttctacgcctccatcgagcagggc
agatcctccgcctcccgcggcggcatcggcgcggtgatgggggacaagggggtcaaggct
gtggtcgttcgcggcaccaaggacctctgcgtcgccaagcccgaggagttcaacaacctc
tgcggcgaggtgctcgactacatcaagcaccgcgaggacaacccgatccccgacgtgatg
cccatcctggccgggctcgggagcccgcaggagatgaaggtccacgacgagaagtggcac
accgagaacttcaactggggcaacgcccgtacccgccgcaaggacttctggaccgacgag
gtgagccacgcctgggaagagaccatggataaggcgaggacccgcctcatcagctgcttc
aactgtcccatgaagtgcggcgccaccatctccatggaggggctccccacctacatgatg
aagtgcttcaccaagctcacctacaccatggcggccttctccgacctcgactttggcctg
aggatggcgcagaaggcgaccgagtacggcctggacggcttctcgaccccgcaggtgatg
gccttcgcgatggagcttttggagaaggggatactgaagcagagcgacttccccggcatg
cccgatgagaacgacgcgaagttcttctacctcctggacctgatcgtgaaccgccagggg
atcggcgacatcctggccgaggggacctactgggccgcgaagaagatcggcaacggcgcc
gaggagtacgcccacaacaacatcaagaagcacgagcagctccccttgaagctctccatg
ctgaaccccatctactacctgatgtactgcaccggggagaagatcaacatcacccagatc
gaggggcagttcccgcaggcgccgtacccgaaagtggagcagcgcgaggagttcgtgaag
gactgggtccaggttcccgacgacaagttcaaggacatcttcctgcagtgggagccgcgc
ggcgagaagtcgatgcccaacttcccgacggtcgacatgtgctgcgacatcgtggactgg
caggagatgatgcactacatcgacgacgcgctggggcagtgcgcggggctttcctccttc
ccgctgaagccgccgtaccacatccacaactacccgaaattcatctccgccggcgccggc
atcgagatggacaaggacaagctcaccaaggccgccaagcgctaccgtaccctggtgcgt
gccatcaacatccgccgcggcatgagaagggtcgacgagcagccgccggcgaaccactgg
aagaaccggttcccggaactggagaaggatcttctcgattcctactacaagctcaagggg
tggaacgacgacggcatcccgaccaaggagaccctggaggagctggggcttggctacgtg
gcgagggagttcgagaagaccggcgtctatgacggcaagccggccgtaaccgccgcggcc
acgcaggagacacttttaagtggaggggtacagccgtga

DBGET integrated database retrieval system