KEGG   Geobacter bemidjiensis: Gbem_1460Help
Entry
Gbem_1460         CDS       T00749                                 

Gene name
bamN
Definition
(GenBank) thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbm  Geobacter bemidjiensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbem_1460 (bamN)
   00630 Glyoxylate and dicarboxylate metabolism
    Gbem_1460 (bamN)
   00640 Propanoate metabolism
    Gbem_1460 (bamN)
   00650 Butanoate metabolism
    Gbem_1460 (bamN)
  Lipid metabolism
   00071 Fatty acid degradation
    Gbem_1460 (bamN)
   00072 Synthesis and degradation of ketone bodies
    Gbem_1460 (bamN)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbem_1460 (bamN)
   00310 Lysine degradation
    Gbem_1460 (bamN)
   00380 Tryptophan metabolism
    Gbem_1460 (bamN)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gbem_1460 (bamN)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbem_1460 (bamN)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gbem_1460 (bamN)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gbem_1460 (bamN)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbem_1460 (bamN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1689687..1690862
Genome map
AA seq 391 aa AA seqDB search
MSDVYVIESLRTPLGSFGGALSDVEAPRLAATVITGIMERTGLPAEAIDEVIVGQVLSGG
SGQAPARQAMRYAGLPDTVPALTINKVCGSGLKAIMLGAGSIKLGDAQLVLAGGMENMSL
APYALSKGRYGYRMGNGEMLDLLVHDGLTDPYSGKHMGVIAEQSAGDNKLDRTLQDSFAL
ASYQKAQAALKDGIFNDEIVPVVKKTRQGEVVVREDEEPHKVDFKKLPELRAAFQKDGTI
TAGNASTINDGAAMALLASGEAVAKYGLKPKARLVAYATNSVHPDQFAEAPVGAIAKVCA
KAGLTTDDIDLFEINEAFAAVPLIACQRLRLDPERVNVNGGAVALGHPLGASGARITATL
VRELHKRKQRYGLATLCIGGGEAVAVILERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtctatgtcatcgaatcactgcgtaccccgttgggctccttcggcggagcg
ctgagcgacgtagaagcgccgcgtctcgccgccaccgtcatcaccggcatcatggaacgc
acagggcttcccgctgaagccatcgacgaggtgattgtcggccaggttctctccggcggc
tcggggcaggctcccgcgcgtcaggccatgcgctatgcggggctccccgacacggtcccc
gccctcaccatcaacaaggtctgcggctcgggccttaaagccatcatgctcggcgccggt
tccatcaagcttggcgacgcccaactggtgctcgcgggcggcatggagaacatgtcactt
gccccctacgcgctcagcaaaggtcgctacggctaccgcatggggaacggcgagatgctg
gacctgctggtccacgacggcctgaccgacccctacagcggcaagcacatgggggtgata
gcggagcaaagcgccggcgacaacaagctggaccgcaccctccaggacagcttcgcgctc
gcctcctatcagaaggctcaagcggctctgaaagacgggatcttcaacgacgagatagtc
ccggtggtgaagaagacgcgccagggcgaggtggtcgtccgcgaggacgaggagccgcac
aaggtcgacttcaagaaactcccggagctccgcgccgccttccaaaaggacggcaccatc
accgcgggtaacgcctctaccatcaacgacggcgccgccatggcgcttctggcgagcggc
gaggccgtggccaaatacgggctgaagcccaaagcccgcctggtcgcctacgccaccaac
agcgtccatcccgaccagttcgccgaagccccggtaggcgccatcgccaaggtctgcgcc
aaggccgggctcactaccgacgacatcgacctcttcgagatcaatgaggccttcgccgcg
gtcccgctcatcgcctgccaaaggctgcgcctcgatccggagcgcgtcaacgtgaacggc
ggcgcggtggcgctcggccacccgctaggcgcaagcggtgcgcgcatcaccgccaccttg
gtgcgggaacttcacaaacgcaaacaacgctacggtctcgccaccctctgcataggcggc
ggcgaggcggtcgcggtaatcctggaaagggtttag

DBGET integrated database retrieval system