KEGG   Geobacter bemidjiensis: Gbem_1498Help
Entry
Gbem_1498         CDS       T00749                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gbm  Geobacter bemidjiensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gbem_1498 (galU)
   00052 Galactose metabolism
    Gbem_1498 (galU)
   00500 Starch and sucrose metabolism
    Gbem_1498 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Gbem_1498 (galU)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gbem_1498 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1732833..1733699
Genome map
AA seq 288 aa AA seqDB search
MRVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRGK
RAIEDHFDISFELESLLYEKGKDQELHQVRKIAEMANIFFVRQKEALGLGHAILCAKEFI
GDEPFAVLLGDDIIDAQQPCLSQLLETYESYRSPVLALEQVPIETISSYGCVRANHLANR
AFEVLDLVEKPPVAEAPSDLAIIGRYILTPGIFPILENQEPGKGGEIQLTDAIKTLSREE
SIYGCRFDGIRHDCGDKLGFLKATVDMALKRDEFNGEFLAFLRKRLGC
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaagaaggccgttttccccgtcgccggtctcggcaccaggtttttgcccgcg
accaaatcgactcccaaggagatgctgccgctcatagacaagccgctggtccagtacgtg
gtggaggaggcggtcgcgtccggcatcgagcagatcctcttcgtcaccggacgcggcaag
agggcgatcgaggatcacttcgacatctccttcgagctggaatcgcttctctacgagaaa
gggaaggaccaggaactgcaccaggtgcgtaagatcgcggagatggccaacatcttcttc
gtgcgccagaaggaggcgctggggcttggccacgccatcctctgcgccaaggaattcatc
ggcgacgagcctttcgccgtccttttgggcgacgacatcatcgacgcgcaacagccctgc
ctgtcccagctcctggagacctacgagagctaccgctctcccgtactggccctggagcag
gttcccatcgagaccatctcctcctacggctgcgtacgcgcgaaccacctggccaaccgc
gccttcgaggtgctcgatctggtggagaagccgccggtcgccgaggccccgtcggatctc
gccatcatcggccgctacatactcaccccggggatcttcccgatcctggagaaccaggag
ccggggaagggtggggagattcagctcaccgacgccatcaagacgctctcgcgcgaggag
tcgatctacggctgccgtttcgacggcatacgccacgactgcggggacaagctgggattt
ttgaaggcgacggtggatatggcgctgaaaagggacgagttcaacggggagtttctggcg
tttttaaggaagaggcttggctgctaa

DBGET integrated database retrieval system