KEGG   Geobacter bemidjiensis: Gbem_1597Help
Entry
Gbem_1597         CDS       T00749                                 

Gene name
cheB-2
Definition
response receiver chemotaxis protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gbm  Geobacter bemidjiensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gbm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gbm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1850880..1851950
Genome map
AA seq 356 aa AA seqDB search
MVKKKIKVLIVDDSAVVRQTLSEILSSDPQIEVMSTAGDPFIAAERIRHEVPDVITLDVE
MPRMDGITFLHKIMSQHPIPVVMCSSLTEMGSETALKALEYGAVEIIQKPRLGTKTFLEE
SRVRICDVVKAASQARVRKVSAAPHQVAPKLSADVIMEKPKSQAMMQTTEKVVVIGASTG
GTEALRTFLESLPADSPGIVIVQHMPEGFTRAFSQRLDGLCRITVKEAENNDTVVRGRAL
IAAGNHHLLLKRSGARYYVEIKDGPLVSRHRPSVDVLFRSAARYAGKNAVGVIMTGMGDD
GAHGMLEMKQAGAVNIAQDEASCIVFGMPNEAIKLGGVDLVRPLDAISREVLRLCA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagaagataaaagtgcttatagtggacgattcggcggtggtgcgtcagacc
ctgtcggagatcctctcctccgatccccagatcgaggtgatgtcgacggccggcgatccc
ttcatcgcggcggagcgcatcaggcacgaggtccccgatgtcatcaccctcgacgtcgag
atgccgcgcatggacggcatcactttcctgcacaagatcatgagccagcatcctatcccg
gtggtgatgtgctcaagcctcaccgagatggggtcggagaccgcgttaaaggcgcttgag
tacggggcggtggagatcatccagaagccgcgccttgggaccaagaccttcctcgaggag
tccagggtgaggatctgcgacgtggtgaaggcggcgagccaggcgagggtcaggaaggtg
tcggcggccccgcaccaggtagccccgaagctttccgccgacgtcatcatggagaagccc
aagagccaggctatgatgcagaccacggaaaaagtggtcgtaataggcgcctccaccggc
ggcaccgaggcgctgcgcaccttcctggagtcgctgccggccgactctcccggcatcgtc
atcgtgcagcacatgccggaaggtttcacccgcgccttttcgcagcggctggacgggctt
tgccggatcacggtcaaggaggcggagaacaacgacaccgtggtgcgaggccgggcgctg
atcgctgccgggaaccaccatctccttttgaaaagaagcggcgcccgctactacgtcgag
atcaaggacgggccgctggtctcgcggcaccgcccctccgtggacgtgcttttcaggtcc
gccgcgcgttacgccggcaagaacgccgtcggcgtcatcatgacggggatgggggacgac
ggcgcgcacggcatgctggagatgaagcaggccggtgccgtgaacatcgcccaggacgag
gcgagctgcatcgtcttcggcatgcccaacgaggcgatcaagctggggggggtcgacctg
gtgcgtcccctcgacgccatcagccgcgaagtcctgaggctttgcgcgtga

DBGET integrated database retrieval system