KEGG   Geobacter bemidjiensis: Gbem_1615Help
Entry
Gbem_1615         CDS       T00749                                 

Gene name
asnB-4
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbm  Geobacter bemidjiensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbem_1615 (asnB-4)
Enzymes [BR:gbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Gbem_1615 (asnB-4)
Peptidases [BR:gbm01002]
 Cysteine Peptidases
  Family C44
   Gbem_1615 (asnB-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1873762..1875624
Genome map
AA seq 620 aa AA seqDB search
MCGIFGALSPQSAPVEQLYEKIASLAHRGPDDSGCWVSPDRTVVLGHRRLSILDLSQAGH
QPMASSCGRYHIVFNGEIYNYLEIRDELAALGFLFSGSGDTEVVLASYRQWGADCLGRFN
GMFALAIWDEGDVANQPRLFMARDRAGKKPFYYVHDGRSLRFASELKALGPGKSVDLRAL
NFYLALGYVPDTLCIAAGAKKLPPAHAGYFLPESGELETWRYWSLPQNLPDPGRGCEDLA
DEAESLLRDSVAMRLRSDVPVGVLLSGGLDSSLVVAAAAQASTTPIKTFTVSFPGTRYDE
AGYAAIVARHFGTEHHVLEVPQPSLGTLDAFSPLIDEPLADSSLLPAFMVSRLTVQHVKV
ALGGDGGDELFGGYADYTMAAADQRCLGWIPKPLLLAAGRAAGALPAGVKGRNRLFALQG
GAYESMIWGSPYFDLSLRRRILASEQVQALGEQLDEPERWLMSLFRTGRDPLDCMTRTHF
GGILPDDFLVKVDRASMAVSLELRAPLLDYRLVEFAFGRLPSHWKVQGQESRRLQKVLGR
RMLPPQLDINRKQGFSIPLDSWLRSSRGGEVEEMRRWLPDCIVQDEVARLIAGHLKGRAN
GSRLFALMMLALSQKNSQEN
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctttggagcactatcgccgcagtccgccccggtggagcaactgtacgag
aagattgccagcctcgcccaccgcggtcccgatgactcaggatgctgggtctcaccggac
cggaccgtcgtcctcggccaccgtcggctctctatcctggacttgtctcaagctggacac
cagcccatggccagttcgtgcggccgctaccacatagtctttaacggtgagatctacaac
taccttgagatcagggacgaactggccgcactgggattccttttttctggcagcggcgat
accgaggtcgtcctcgcctcctaccgccagtggggcgcggactgtctggggcgctttaat
ggcatgttcgctctggccatttgggatgagggagatgtcgccaaccagccccgtctgttc
atggcgcgagaccgggcggggaagaagccgttttattacgtccacgatgggcgttcgtta
cgcttcgcttccgaattgaaggcgcttggcccgggaaagagtgtcgacctgcgcgcgctg
aatttctacctcgccttgggctacgtacccgacacgctctgcatcgctgccggggctaaa
aagcttccccccgcccatgccggctacttcctccccgaaagcggggagcttgagacctgg
cgctattggagcctgccccagaacctccctgacccgggccgcgggtgcgaagatctcgcg
gacgaggcggagagcctgctgcgggattcggttgccatgcgtctgcgcagcgacgtgccc
gtgggggtgttgctatcgggggggttagactcgagtctggtggtggcagccgccgctcag
gcctcgaccacgccgatcaagaccttcaccgtttcgttccccggcacccgctacgacgag
gcaggatacgccgccatcgtggcgcgccacttcgggaccgagcaccacgtgctggaggtc
ccccagccatcgttggggaccctagacgctttctctcccttaatagacgagccacttgcc
gactcttcgcttctgcctgctttcatggtctcccggttaaccgtgcagcacgtaaaggtg
gcgcttggtggcgacggcggcgacgaacttttcggcggctacgccgactacaccatggca
gctgcggaccagcgctgtctgggctggataccgaagccgctgctgttggcggcgggccgt
gcggcgggagcactgcccgccggggtcaaggggcgcaaccgcctctttgccctgcagggt
ggggcgtacgagtccatgatatggggaagcccttatttcgacctctcgctgcgccgtcgc
atcttggcctcggagcaggttcaggcccttggtgaacagttggatgagccggagcgttgg
ctgatgtcgctgttccggaccggccgcgaccctcttgactgcatgaccagaacccatttc
ggaggcattttgccggacgacttcctggtgaaggtggatcgagcgagcatggcggtgagc
ctagagcttcgcgccccgctccttgactaccggctggtcgagttcgccttcggcaggttg
ccttcccattggaaggtacaggggcaggaaagtcgccggctccagaaggtgctaggccgt
cgcatgctccccccccagctcgacatcaacagaaaacagggattctccatacctttggac
agctggctgcgcagttcccgggggggcgaggtcgaggaaatgcgccgctggttaccggac
tgcatcgtacaggacgaggttgcgaggctcatcgccgggcatctgaaagggcgtgctaac
ggctcgcgcctcttcgcattgatgatgcttgccttgtcacaaaaaaatagccaggagaat
tag

DBGET integrated database retrieval system