KEGG   Geobacter bemidjiensis: Gbem_1886Help
Entry
Gbem_1886         CDS       T00749                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gbm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2185370..2186281
Genome map
AA seq 303 aa AA seqDB search
MGKAGGKMENRIRMIGVPLDLGQEQRGVDLGPGALRYAGLSARLTGLGYQVEDIGNLEVP
VRDVVTAERQQHYLPSIGKVCETVYQAGRTAVAQGCIPVFMGGDHSLALGSIGGVTHEQP
TAVIWVDAHGDFNTPETSPSGNIHGMVLAALLGEGHSELVHLGRPGPKLSGSDVVLIGLR
ELDPQEKVRLRESSVNVYTMRDIDERGIGAIAREALGKLAHRTRLHLSLDLDGLDPLEVP
GVGTTSPGGITYREAQLLMEIIADTKLLCSMDIVEINPILDHGNRTAKIAVELAASAFGE
AIM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggctggggggaagatggaaaaccgtatcaggatgataggcgtgccgctggac
ctggggcaggagcagcgcggcgtcgacctggggccgggggcgctgcgctatgcggggctg
tcggctcgcctcaccggtctggggtaccaagtggaggatatagggaacctggaggtgccg
gtacgtgacgtggtgaccgctgagcggcagcagcattaccttccctcgatagggaaggtc
tgcgagacggtttatcaggcagggcgcacggcggtggcgcaaggttgcatccccgtcttc
atggggggggaccattcgctggcgcttggctccataggcggcgtgacccatgaacagccg
acggcggtgatctgggtcgacgcccacggcgacttcaacacgcctgagacctcccccagc
gggaacattcacgggatggttttggcggcgcttttgggggaagggcattcggaactggtg
cacctggggaggccggggccgaagcttagcggcagcgacgtggtcctgatcgggctgcgg
gagctggatccgcaggagaaggtcaggctgcgggagagttcagtcaacgtctacaccatg
agggacatagacgagcggggcatcggcgccatcgcgcgggaggcgctgggaaagctcgcc
cacaggacccgcctgcacctgagcctcgatctcgacggcctggacccgctggaggttccc
ggcgtcggcaccacctcgccgggagggatcacctaccgcgaggcccagctcctgatggag
atcatcgccgatacgaagcttctttgctccatggacatcgtggagataaacccgatcctg
gaccacggcaaccgcaccgcaaaaatcgccgtggaactggccgcctccgctttcggggag
gcgatcatgtaa

DBGET integrated database retrieval system