KEGG   Geobacter bemidjiensis: Gbem_1886Help
Entry
Gbem_1886         CDS       T00749                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00220  Arginine biosynthesis
gbm00330  Arginine and proline metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01130  Biosynthesis of antibiotics
gbm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Gbem_1886
   00330 Arginine and proline metabolism
    Gbem_1886
Enzymes [BR:gbm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Gbem_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACH38900
JGI: Gbem1886
UniProt: B5EB39
Position
2185370..2186281
Genome map
AA seq 303 aa AA seqDB search
MGKAGGKMENRIRMIGVPLDLGQEQRGVDLGPGALRYAGLSARLTGLGYQVEDIGNLEVP
VRDVVTAERQQHYLPSIGKVCETVYQAGRTAVAQGCIPVFMGGDHSLALGSIGGVTHEQP
TAVIWVDAHGDFNTPETSPSGNIHGMVLAALLGEGHSELVHLGRPGPKLSGSDVVLIGLR
ELDPQEKVRLRESSVNVYTMRDIDERGIGAIAREALGKLAHRTRLHLSLDLDGLDPLEVP
GVGTTSPGGITYREAQLLMEIIADTKLLCSMDIVEINPILDHGNRTAKIAVELAASAFGE
AIM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggctggggggaagatggaaaaccgtatcaggatgataggcgtgccgctggac
ctggggcaggagcagcgcggcgtcgacctggggccgggggcgctgcgctatgcggggctg
tcggctcgcctcaccggtctggggtaccaagtggaggatatagggaacctggaggtgccg
gtacgtgacgtggtgaccgctgagcggcagcagcattaccttccctcgatagggaaggtc
tgcgagacggtttatcaggcagggcgcacggcggtggcgcaaggttgcatccccgtcttc
atggggggggaccattcgctggcgcttggctccataggcggcgtgacccatgaacagccg
acggcggtgatctgggtcgacgcccacggcgacttcaacacgcctgagacctcccccagc
gggaacattcacgggatggttttggcggcgcttttgggggaagggcattcggaactggtg
cacctggggaggccggggccgaagcttagcggcagcgacgtggtcctgatcgggctgcgg
gagctggatccgcaggagaaggtcaggctgcgggagagttcagtcaacgtctacaccatg
agggacatagacgagcggggcatcggcgccatcgcgcgggaggcgctgggaaagctcgcc
cacaggacccgcctgcacctgagcctcgatctcgacggcctggacccgctggaggttccc
ggcgtcggcaccacctcgccgggagggatcacctaccgcgaggcccagctcctgatggag
atcatcgccgatacgaagcttctttgctccatggacatcgtggagataaacccgatcctg
gaccacggcaaccgcaccgcaaaaatcgccgtggaactggccgcctccgctttcggggag
gcgatcatgtaa

DBGET integrated database retrieval system