KEGG   Geobacter bemidjiensis: Gbem_1896Help
Entry
Gbem_1896         CDS       T00749                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00240  Pyrimidine metabolism
gbm00250  Alanine, aspartate and glutamate metabolism
gbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Gbem_1896 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbem_1896 (pyrB)
Enzymes [BR:gbm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Gbem_1896 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACH38910
JGI: Gbem1896
UniProt: B5EB49
Position
2195128..2196060
Genome map
AA seq 310 aa AA seqDB search
MGFRHKDIIALKDLTKEEITLLLDTADSLSEINQRDIKKVPTLRGKTVINLFYEASTRTR
TSFEIAAKRLSADAVNITASTSSVVKGETLSDTANNLLAMKPDIIVMRHAVSGAHEYLAK
RVSCSVINAGDGAHEHPSQGLLDMLTMRQKFGKLDGLKVAIIGDITHSRVARSDIYGLTT
MGSHVFLAGPPTMMPVGIERLGNVTVCKDMREAVDKADVVMMLRIQLERQGKTLLPSMRE
YSRYFGLNPEVLGLAKKNAIVMHPGPINRGVELASSVADCDQSAILTQVENGVAVRMAML
YHVCGGEPVE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaggcataaagacatcatcgccctgaaggatctgaccaaggaggagatcacg
ctccttctggacacggctgacagtctcagcgagatcaaccagcgggacatcaaaaaggtg
ccgacgctgcgcggcaaaacggtgatcaacctcttttacgaggcatccaccaggacccgc
acttcgttcgagattgccgccaaaaggctttccgccgatgcggtgaacatcaccgcgtcc
accagttccgtggtcaagggcgagacactgtccgacaccgccaacaacctcctcgccatg
aagcccgacatcatcgtgatgcgccacgccgtttccggcgcccatgaatacctagccaag
cgggtctcctgctcggtcatcaacgccggcgacggcgcccacgagcacccttcccagggt
cttttggacatgctcaccatgcgccagaagttcggcaagctggacgggctgaaggtagcc
atcatcggcgacatcacccacagccgcgtggcccgctccgacatctacggcctcaccacc
atgggctcccacgtattcctcgccggtccgccgaccatgatgccggtcggcatcgagcgg
cttggcaacgtcacggtctgcaaggacatgcgggaggccgtggacaaggccgatgtggtg
atgatgctgaggatccagttggagcgccagggcaagaccctgctccccagcatgcgcgag
tactcgcgctacttcgggctcaaccccgaggtgctcggcctggccaagaagaacgccatc
gtcatgcatccgggtcccatcaaccgcggcgtcgagctcgcctcctcggttgccgactgc
gaccagtccgccatcctgacccaggtggaaaacggcgtggcggtgcgcatggcgatgctg
taccacgtctgcggcggcgagccggtggagtaa

DBGET integrated database retrieval system