KEGG   Geobacter bemidjiensis: Gbem_1957Help
Entry
Gbem_1957         CDS       T00749                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01130  Biosynthesis of antibiotics
gbm01230  Biosynthesis of amino acids
Module
gbm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbem_1957 (trpC)
Enzymes [BR:gbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Gbem_1957 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh CdhD
Motif
Other DBs
NCBI-ProteinID: ACH38971
JGI: Gbem1957
UniProt: B5EBU7
Position
2261373..2262173
Genome map
AA seq 266 aa AA seqDB search
MTQLPDVLKKIVDYKQGEVAAMKAEVPLNEIMDRLAELEDHPRGFQAALINSLSSGWTPI
IAEVKKGSPSKGLIRPDFDPLQIARTYQENGATCLSILTDEHFFMGHLSYLAAIREEVSL
PLLRKDFIFDPYQIYQARAAGADAILLIAAMLDLPQLRDFAALAQELSMDVLLEVHDEKE
LETALQTDCSMIGINNRDLRSFVVDIRTSERLAALVPQGRLVVAESGINRREEIVHLMSM
GLHAFLIGESLMREDDFGAKLRELVG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctccccgatgtgctgaaaaaaatagtcgattacaagcagggcgaagtcgcg
gccatgaaggcggaagtgccgctgaacgaaatcatggaccggctcgccgaactggaagac
cacccccgggggttccaggcagcgctcatcaactcgctctcctcgggatggacccccatc
atcgcggaggtgaagaaggggtccccgtccaaggggctgatcaggcccgacttcgacccg
ctgcagatagcccggacctaccaggaaaacggcgccacctgcctctccatcctcaccgac
gagcatttcttcatggggcacctgagctacttggccgccatccgcgaagaggtttcgctc
ccgcttctgcgcaaggacttcatcttcgacccctatcagatctaccaggcccgcgccgcc
ggggccgacgccatcctcctcatcgccgccatgctggatctcccccagttgcgggacttc
gccgcgctggcccaggagctctccatggacgtgctcctggaggtgcatgacgagaaggag
ctggagacggccctgcagaccgactgcagcatgatcggcatcaacaaccgcgatctaagg
agcttcgtggtcgacatccgcacctcggagcgtctggccgcgctggtgccgcaggggcgc
ctggtggtagcggaaagcggcatcaacaggcgcgaggagatcgtgcacctcatgtcgatg
gggctgcacgcctttctcatcggcgagtcgctgatgcgcgaggacgacttcggcgcgaag
ctgcgcgaactggtgggttaa

DBGET integrated database retrieval system