KEGG   Geobacter bemidjiensis: Gbem_1958Help
Entry
Gbem_1958         CDS       T00749                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, homodimeric beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbem_1958 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_1958 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbem_1958 (trpB2)
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gbem_1958 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2262203..2263558
Genome map
AA seq 451 aa AA seqDB search
MNTKFMLDESRIPKQWYNIIPDMPGPLHPVVNPQTLKPVTPEDMSVIFPMSLIEQEMSTE
RWIDIPEDVREKYRLWRPAPLFRARRLEQALQTPAKIYYKYEGVSPAGSHKPNSAIPQAY
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTIYMVKVSCTQKPYRKSMMQLWGATV
IPSPSEFTNAGRSILAHDPNNLGSLGIAISEAVEDAATHDDTNYALGSVLNHVCLHQTVI
GLEAKEQMELAGDYPDIVIACCGGGSNFAGLAFPFLSDRANGKKVRCLAVEPASCPTLTK
GIYAFDYGDTAKLAPITKMYTLGHDFMPPGIHAGGLRYHGESALISQLYHAGEIEAKSYK
QNACFEGALLFARSEGIVPAPESSHAVRAAIDEAVLAKEEGKEKTILFGLSGHGQLDMMA
YDAYLSGALEDFEYPEEMIRQSLERLPKVSF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaagtttatgctcgatgaatcccgcatccctaaacagtggtacaacatcatc
cccgacatgcctgggccgctgcatcctgtcgtaaacccgcagaccctgaagccggtgact
ccggaggacatgagcgtcatcttccccatgtcgctgatcgagcaggagatgtcgaccgag
cgttggatcgatattcccgaagacgtgcgcgagaaataccggctctggcggccggccccg
cttttcagggccagaaggctggagcaggcgctgcagaccccggcgaagatctattacaag
tacgaaggggtctcgcccgccggctctcataagccgaactccgccatcccgcaggcctac
tacaacaagcaggcgggtatccgcaggctcgccaccgagaccggcgcggggcaatggggt
agctcgctggctctggcctgctccatgttcgggctggagtgcaccatctatatggtgaag
gtctcctgcacccagaagccgtaccgaaagagcatgatgcagctttggggcgcgacggtg
atcccgtccccctccgagttcaccaacgcggggcgctcgattctggcgcatgacccgaac
aacctgggaagcctcggcatcgccatctccgaggcggtagaggacgcggcgacccacgac
gacacgaactacgcgctggggagcgtcttgaaccacgtctgcctgcaccagaccgtgatc
gggctggaggcgaaggagcagatggagctggccggggattacccggacatcgtcatcgcc
tgctgcggcggcggctccaacttcgccgggctcgccttccccttcctctccgaccgcgcc
aacgggaaaaaggtgcgctgcctggcagtggagccggcttcctgcccgaccctgaccaag
gggatttacgccttcgattacggcgacacggcgaagctcgcccccatcaccaagatgtac
accctggggcacgacttcatgccgccggggatccatgccggcgggctgcgttaccacggc
gagtccgcgctcatctcccagctctaccacgccggagagatcgaggcgaagtcgtacaag
cagaacgcctgcttcgaaggggccctgctcttcgccaggagcgaggggatcgttccggcg
ccggaatcctcccatgcggtgcgcgccgccatcgacgaggcggtgctggccaaggaggaa
gggaaggagaagaccatcctcttcgggctttccggccacgggcagctcgacatgatggct
tacgacgcctacctctccggcgcgctcgaggacttcgagtaccccgaggagatgatccgg
caatcgctggagcggctgccgaaggtttccttctag

DBGET integrated database retrieval system