KEGG   Geobacter bemidjiensis: Gbem_2002Help
Entry
Gbem_2002         CDS       T00749                                 

Definition
(GenBank) glucose 6-kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00052  Galactose metabolism
gbm00500  Starch and sucrose metabolism
gbm00520  Amino sugar and nucleotide sugar metabolism
gbm00521  Streptomycin biosynthesis
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2002
   00052 Galactose metabolism
    Gbem_2002
   00500 Starch and sucrose metabolism
    Gbem_2002
   00520 Amino sugar and nucleotide sugar metabolism
    Gbem_2002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gbem_2002
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Gbem_2002
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gbem_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACH39015
JGI: Gbem2002
UniProt: B5EBZ1
Position
2306855..2307838
Genome map
AA seq 327 aa AA seqDB search
MVILAGDVGGTSTRLAYFESAATGLVVLAEGRYQSQEHSSLSDIVRRFAAQSRLDADRAC
FGIAGPVIDGRVRTPNLPWNIDGSELAQALGLGQVRLINDLEANTYGIAELKAQDLLTLN
PGVADPTGTIAVVSAGTGLGESLAYWDGSSHRPLPSEAGHADFAARNEIEADLLLYLQAK
HGRVSYERVLSGPGLLDIYRFLRDRHYFQEDEAIIAAMNAGDAPAVITRAAMDGSCPMCS
KALDIFITVYGAEAGNAALRFLATGGVYLGGGIAPKILDKLRGASFIVAFTAKGRLSSLV
QTIPVHVILNERTALLGAGRAASISSS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcatacttgctggagacgtcggcgggacctccacccggctagcctacttcgaatcc
gctgcaaccgggctcgtggtgctggccgaggggcgctaccaaagccaggaacacagcagc
ctctccgacatcgtgcggcgctttgccgcccaatcccgcctggatgccgacagggcctgc
ttcggcatagcgggaccggtcatcgacgggcgggtaaggaccccgaacctcccctggaac
atcgacggcagcgaacttgcccaagccttgggccttggccaggtgcgcctgatcaacgat
ttagaggccaacacctacggcatcgcggaactgaaggcccaggacctgctgacgctcaac
cccggagtggcggaccccacaggcaccatagccgtggtttccgccggcaccggccttggc
gagtcgcttgcctactgggacggctcctcccacaggccgcttcccagcgaggcggggcat
gccgatttcgcagcgcgcaacgagatcgaggccgatcttttgctatacctccaggcgaag
catggccgggtcagctacgagcgcgtcctgtccggtccggggctcctcgatatctaccgc
tttctcagggacaggcattacttccaggaggatgaagccatcattgccgccatgaacgcg
ggcgacgcccctgcggtcatcacccgcgccgcaatggacggaagttgcccaatgtgcagc
aaggctctcgatatcttcatcaccgtgtacggtgccgaagccgggaacgcggctctcaga
tttctcgccaccggcggagtctatcttggcggggggattgcgcccaagatcctggacaag
ctgcgcggggcttccttcatcgttgcctttaccgcaaaagggcgacttagctctttggtg
caaacaattccggtgcacgtcatattaaatgagagaacagcactgctaggtgcgggaagg
gctgcttcaatctcatccagttga

DBGET integrated database retrieval system