KEGG   Geobacter bemidjiensis: Gbem_2107Help
Entry
Gbem_2107         CDS       T00749                                 

Definition
SGNH-hydrolase lipoprotein, lysophospholipase L1-like subgroup
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Gbem_2107
Enzymes [BR:gbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Gbem_2107
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Gbem_2107
Lipid biosynthesis proteins [BR:gbm01004]
 Fatty acid synthase
  Component type
   Gbem_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2445551..2446222)
Genome map
AA seq 223 aa AA seqDB search
MCNLRFIALTIIFAVLLVSCHKEKEPAAVNATEKPASRGTIVAVGDSLTAGYGVPETDAY
PAQLERKLNEAGYKWRVVNAGISGETSTGTLARIDWILKLRPDIVILETGANDGLRGQAP
ELTRKNTDSIVTALQAKNVVVVLAGMQMLTNMGSPYRDKFVAIYPRVAKERKLILVPFFL
DKVAGEENLNLSDGIHPNPQGYAIVTETIFPYVLQAIKLKTGS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaacttgagattcattgccctaaccatcatattcgccgtcctcctggtctcatgc
cataaggaaaaggagcctgccgccgtgaacgccacggaaaaaccagcatcacgcggaacc
atcgtcgcggtcggcgacagccttaccgccgggtacggcgttcccgagaccgacgcctac
ccggcccagttggagcggaagctcaacgaggcagggtataagtggcgcgtggtgaacgcc
ggcatcagcggcgagaccagcaccggcaccctggcccgcatcgattggatactgaagctt
cggccggacatcgtgatcctcgaaaccggcgccaacgacgggttgcgcgggcaggccccg
gaactcacccgcaagaacaccgacagcatagttaccgccttgcaggctaaaaacgtggtc
gtggtcctggcggggatgcagatgctcaccaacatgggctcgccctatcgggacaagttc
gtggcgatctatccgcgggtcgccaaagaacgaaagcttattctggtcccgtttttcctg
gataaagtcgctggagaagagaacctcaatctctcggacggcatccatccgaatccacag
ggttacgccattgtcaccgagacgatctttccctacgtgcttcaggccataaagctcaaa
accggaagctga

DBGET integrated database retrieval system