KEGG   Geobacter bemidjiensis: Gbem_2133Help
Entry
Gbem_2133         CDS       T00749                                 

Gene name
mutM-1
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gbm  Geobacter bemidjiensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gbm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2481465..2482274
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVTRLGIAAQLVGARIAAVAIRSAKLRTMVPQELPRLLVGQSILSLTRRGKYL
IITCRQGSLLLHLGMTGHLRLVPAGAGAGVHDHFDLELESSLILRLNDVRRFGSIHFTSG
DPLKHKLLQGIGPEPLTDELTGPYLYRKSRGKKAPLQRFLMDSSVVAGLGNIYAAETLFR
CGMLPPTPAGSLSEADCDRLCDCIKKTLAASIEAGRVMDFSVREEKLVYFPQQLFVYGRE
GLACRQCGSAIERGRLGNRSTFYCPRCQS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattacctgaagtcgaagtgacgcggcttgggatcgccgcacaactggtcgga
gccaggatcgccgctgtcgccattcgcagcgccaaactgcgcaccatggtgccgcaggaa
ctcccgcgtcttcttgtcggccagagcatcctttcgctgacccgtcgcggcaagtacctg
atcattacctgccggcaaggctccttgctgctgcacctgggcatgaccgggcacctgcgc
ctggttcccgccggagccggcgcaggcgtgcacgaccacttcgacctggagcttgagtcc
agccttatattgcggctcaacgacgtgcgccgcttcggctcgattcacttcacctccggc
gacccgctaaagcacaagcttttgcagggaatcgggccggaacctttgaccgatgagctc
accgggccctacctctaccgcaaaagccgcggcaagaaggcgcccctgcagcgcttcctg
atggatagctccgtggtcgccgggcttggcaacatctacgcggccgagaccctgttccgc
tgcggcatgcttccgcccacacccgcgggctccctctccgaggccgactgcgacaggctt
tgcgactgcatcaagaaaaccctcgccgcctccatcgaggccggccgcgtcatggatttc
agcgtccgcgaggagaagctcgtctatttcccgcaacagctcttcgtctacggcagggaa
gggctcgcctgccggcaatgcggcagcgccatagagcggggaaggctcggcaaccgctcc
accttctactgcccccgctgccagagctag

DBGET integrated database retrieval system