KEGG   Geobacter bemidjiensis: Gbem_2338Help
Entry
Gbem_2338         CDS       T00749                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:gbm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gbm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gbm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:gbm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2714554..2715309
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDSVEIVVAPVFTVLPTLPAALAGTGIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGA
LVPIVCIGETLEAREAGDTFKVLERQLKGGLEGLTGTQFAPVIVAYEPVWAIGTGKVASD
DQAQEAHAFIRGVIAGLFGKSAADKVRILYGGSVKPDNVKGLMSRPDIDGALVGGASLKG
ASFASIVRYSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccggtcatagcaggcaactggaaactgttcaagactaagaacgaggcgctc
gcactgatagaagaattggcaccgctggtttccggcgtggacagcgtggagatcgtggtg
gcgccggtgttcaccgtgctccccaccctccccgctgcgctcgccggcaccggcataagc
cttgccgcccaggacgtattctgggaagaagaaggcgcctttaccggcgaagtttcgccg
cgcatgcttctcgatgccggtgcaagccacgtcatcatcggccattccgaacgccggcag
tatttcggcgagaccgaggaaacggtcaacaagaaggtgaaggccgcactcaaaggggcg
cttgtccccatcgtgtgcatcggcgaaaccctggaagcgcgcgaagctggcgataccttc
aaggtgctggagcgccagctgaagggtgggctcgaggggctgacagggacacagttcgcg
ccggtcatcgtagcctacgagccggtctgggccatcggcaccggcaaggtcgcctccgac
gaccaggcgcaggaggcacatgccttcattcgcggggtcatcgcaggactcttcggcaag
tcggcggcggataaagtgaggattctctacggcggctccgtgaagccggataacgtgaaa
ggactcatgtcgcgccctgacatagacggtgcgctcgtgggaggcgcaagtctcaaaggc
gcatcttttgcctcaatcgtgcgttacagtgaataa

DBGET integrated database retrieval system