KEGG   Geobacter bemidjiensis: Gbem_2338Help
Entry
Gbem_2338         CDS       T00749                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_2338 (tpi)
   01230 Biosynthesis of amino acids
    Gbem_2338 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2338 (tpi)
   00051 Fructose and mannose metabolism
    Gbem_2338 (tpi)
   00562 Inositol phosphate metabolism
    Gbem_2338 (tpi)
Enzymes [BR:gbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gbem_2338 (tpi)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gbem_2338 (tpi)
  Exosomal proteins of bladder cancer cells
   Gbem_2338 (tpi)
  Exosomal proteins of melanoma cells
   Gbem_2338 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2714554..2715309
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDSVEIVVAPVFTVLPTLPAALAGTGIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGA
LVPIVCIGETLEAREAGDTFKVLERQLKGGLEGLTGTQFAPVIVAYEPVWAIGTGKVASD
DQAQEAHAFIRGVIAGLFGKSAADKVRILYGGSVKPDNVKGLMSRPDIDGALVGGASLKG
ASFASIVRYSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccggtcatagcaggcaactggaaactgttcaagactaagaacgaggcgctc
gcactgatagaagaattggcaccgctggtttccggcgtggacagcgtggagatcgtggtg
gcgccggtgttcaccgtgctccccaccctccccgctgcgctcgccggcaccggcataagc
cttgccgcccaggacgtattctgggaagaagaaggcgcctttaccggcgaagtttcgccg
cgcatgcttctcgatgccggtgcaagccacgtcatcatcggccattccgaacgccggcag
tatttcggcgagaccgaggaaacggtcaacaagaaggtgaaggccgcactcaaaggggcg
cttgtccccatcgtgtgcatcggcgaaaccctggaagcgcgcgaagctggcgataccttc
aaggtgctggagcgccagctgaagggtgggctcgaggggctgacagggacacagttcgcg
ccggtcatcgtagcctacgagccggtctgggccatcggcaccggcaaggtcgcctccgac
gaccaggcgcaggaggcacatgccttcattcgcggggtcatcgcaggactcttcggcaag
tcggcggcggataaagtgaggattctctacggcggctccgtgaagccggataacgtgaaa
ggactcatgtcgcgccctgacatagacggtgcgctcgtgggaggcgcaagtctcaaaggc
gcatcttttgcctcaatcgtgcgttacagtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system