KEGG   Geobacter bemidjiensis: Gbem_2338Help
Entry
Gbem_2338         CDS       T00749                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00051  Fructose and mannose metabolism
gbm00562  Inositol phosphate metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01230  Biosynthesis of amino acids
Module
gbm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2338 (tpi)
   00051 Fructose and mannose metabolism
    Gbem_2338 (tpi)
   00562 Inositol phosphate metabolism
    Gbem_2338 (tpi)
Enzymes [BR:gbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gbem_2338 (tpi)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gbem_2338 (tpi)
  Exosomal proteins of bladder cancer cells
   Gbem_2338 (tpi)
  Exosomal proteins of melanoma cells
   Gbem_2338 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACH39350
JGI: Gbem2338
UniProt: B5EF41
Position
2714554..2715309
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDSVEIVVAPVFTVLPTLPAALAGTGIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGA
LVPIVCIGETLEAREAGDTFKVLERQLKGGLEGLTGTQFAPVIVAYEPVWAIGTGKVASD
DQAQEAHAFIRGVIAGLFGKSAADKVRILYGGSVKPDNVKGLMSRPDIDGALVGGASLKG
ASFASIVRYSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccggtcatagcaggcaactggaaactgttcaagactaagaacgaggcgctc
gcactgatagaagaattggcaccgctggtttccggcgtggacagcgtggagatcgtggtg
gcgccggtgttcaccgtgctccccaccctccccgctgcgctcgccggcaccggcataagc
cttgccgcccaggacgtattctgggaagaagaaggcgcctttaccggcgaagtttcgccg
cgcatgcttctcgatgccggtgcaagccacgtcatcatcggccattccgaacgccggcag
tatttcggcgagaccgaggaaacggtcaacaagaaggtgaaggccgcactcaaaggggcg
cttgtccccatcgtgtgcatcggcgaaaccctggaagcgcgcgaagctggcgataccttc
aaggtgctggagcgccagctgaagggtgggctcgaggggctgacagggacacagttcgcg
ccggtcatcgtagcctacgagccggtctgggccatcggcaccggcaaggtcgcctccgac
gaccaggcgcaggaggcacatgccttcattcgcggggtcatcgcaggactcttcggcaag
tcggcggcggataaagtgaggattctctacggcggctccgtgaagccggataacgtgaaa
ggactcatgtcgcgccctgacatagacggtgcgctcgtgggaggcgcaagtctcaaaggc
gcatcttttgcctcaatcgtgcgttacagtgaataa

DBGET integrated database retrieval system