KEGG   Geobacter bemidjiensis: Gbem_2448Help
Entry
Gbem_2448         CDS       T00749                                 

Gene name
pfk-2
Definition
(GenBank) 6-phosphofructokinase, ATP-dependent
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00030  Pentose phosphate pathway
gbm00051  Fructose and mannose metabolism
gbm00052  Galactose metabolism
gbm00680  Methane metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01230  Biosynthesis of amino acids
gbm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2448 (pfk-2)
   00030 Pentose phosphate pathway
    Gbem_2448 (pfk-2)
   00051 Fructose and mannose metabolism
    Gbem_2448 (pfk-2)
   00052 Galactose metabolism
    Gbem_2448 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    Gbem_2448 (pfk-2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Gbem_2448 (pfk-2)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbem_2448 (pfk-2)
Protein phosphatases and associated proteins [BR:gbm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gbem_2448 (pfk-2)
Messenger RNA biogenesis [BR:gbm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gbem_2448 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACH39456
JGI: Gbem2448
UniProt: B5EFZ1
Position
2839689..2840648
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAATRTALGHGVQVLGFRKGYAGLLKGDFLEMQTKDVAGI
LHRGGTFLQSARSEEFRTVLGREKAVRHLEEFGVEGLIVIGGDGSLNGALALHRMGVPVI
GIPASIDNDIPFTDMALGVDTALNNIIYAVDCIKDTASSHDRAFVIEVMGRNSGYLASMA
AIATGAEYAIVPEVECDVADLCNQLRHRWEEGRSNAIIILAEGAGRAQNIADNIKDAIGF
ETRVTVLGHYQRGGAPSVFDRLLGSRFGHAAVENLLAGQMGKMVGLCCNAIVPTLLETVV
VSEKRQQDELHEMSLILGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagggatactcaccagcggcggggactgttcaggcatgaacgcggccatc
agggccgcgaccaggaccgccctggggcacggggtacaggtgctcggcttccgcaagggg
tacgcggggctattgaagggggacttcctcgaaatgcagaccaaagacgtggcggggatc
ctgcaccgcgggggtaccttcctgcaatcggccagaagcgaggaattccgcaccgtcctg
gggagggagaaggcggtgcgccacctggaggagttcggggtcgaggggctgatcgtcatc
gggggggacggctccttgaacggcgcgctggcgctgcaccgcatgggggtgccggtaatc
ggcataccggccagcatcgacaacgacatccccttcaccgacatggcgctcggcgtggac
actgcactcaacaacatcatctatgcggtcgactgcatcaaggacacggcgagctcgcac
gaccgggccttcgtcatcgaggtgatggggcggaattccgggtatctcgccagcatggca
gccatcgccaccggcgccgagtacgccatagtccccgaggtcgagtgcgacgtagccgat
ctttgcaaccagctcaggcaccgctgggaggaagggcgcagcaacgccatcatcatcctg
gccgaaggggccgggcgcgcccagaacatagccgacaacatcaaggacgccatcggcttc
gagacccgggtcaccgtgctcggccactaccagagggggggcgccccttcggtcttcgac
cggctcttgggaagcaggttcgggcacgctgcggtggagaacctcttggccgggcagatg
ggaaagatggtggggctttgctgcaacgcgatcgtgccgacccttttggagacggtggtg
gtaagcgagaagaggcagcaagacgagctgcacgagatgtcgctgatcctcggcatctag

DBGET integrated database retrieval system