KEGG   Geobacter bemidjiensis: Gbem_2448Help
Entry
Gbem_2448         CDS       T00749                                 

Gene name
pfk-2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_2448 (pfk-2)
   01230 Biosynthesis of amino acids
    Gbem_2448 (pfk-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_2448 (pfk-2)
   00030 Pentose phosphate pathway
    Gbem_2448 (pfk-2)
   00051 Fructose and mannose metabolism
    Gbem_2448 (pfk-2)
   00052 Galactose metabolism
    Gbem_2448 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    Gbem_2448 (pfk-2)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbem_2448 (pfk-2)
Protein phosphatases and associated proteins [BR:gbm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gbem_2448 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2839689..2840648
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAATRTALGHGVQVLGFRKGYAGLLKGDFLEMQTKDVAGI
LHRGGTFLQSARSEEFRTVLGREKAVRHLEEFGVEGLIVIGGDGSLNGALALHRMGVPVI
GIPASIDNDIPFTDMALGVDTALNNIIYAVDCIKDTASSHDRAFVIEVMGRNSGYLASMA
AIATGAEYAIVPEVECDVADLCNQLRHRWEEGRSNAIIILAEGAGRAQNIADNIKDAIGF
ETRVTVLGHYQRGGAPSVFDRLLGSRFGHAAVENLLAGQMGKMVGLCCNAIVPTLLETVV
VSEKRQQDELHEMSLILGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagggatactcaccagcggcggggactgttcaggcatgaacgcggccatc
agggccgcgaccaggaccgccctggggcacggggtacaggtgctcggcttccgcaagggg
tacgcggggctattgaagggggacttcctcgaaatgcagaccaaagacgtggcggggatc
ctgcaccgcgggggtaccttcctgcaatcggccagaagcgaggaattccgcaccgtcctg
gggagggagaaggcggtgcgccacctggaggagttcggggtcgaggggctgatcgtcatc
gggggggacggctccttgaacggcgcgctggcgctgcaccgcatgggggtgccggtaatc
ggcataccggccagcatcgacaacgacatccccttcaccgacatggcgctcggcgtggac
actgcactcaacaacatcatctatgcggtcgactgcatcaaggacacggcgagctcgcac
gaccgggccttcgtcatcgaggtgatggggcggaattccgggtatctcgccagcatggca
gccatcgccaccggcgccgagtacgccatagtccccgaggtcgagtgcgacgtagccgat
ctttgcaaccagctcaggcaccgctgggaggaagggcgcagcaacgccatcatcatcctg
gccgaaggggccgggcgcgcccagaacatagccgacaacatcaaggacgccatcggcttc
gagacccgggtcaccgtgctcggccactaccagagggggggcgccccttcggtcttcgac
cggctcttgggaagcaggttcgggcacgctgcggtggagaacctcttggccgggcagatg
ggaaagatggtggggctttgctgcaacgcgatcgtgccgacccttttggagacggtggtg
gtaagcgagaagaggcagcaagacgagctgcacgagatgtcgctgatcctcggcatctag

DBGET integrated database retrieval system