KEGG   Geobacter bemidjiensis: Gbem_3014Help
Entry
Gbem_3014         CDS       T00749                                 

Gene name
pfk-1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00030  Pentose phosphate pathway
gbm00051  Fructose and mannose metabolism
gbm00052  Galactose metabolism
gbm00680  Methane metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_3014 (pfk-1)
   00030 Pentose phosphate pathway
    Gbem_3014 (pfk-1)
   00051 Fructose and mannose metabolism
    Gbem_3014 (pfk-1)
   00052 Galactose metabolism
    Gbem_3014 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    Gbem_3014 (pfk-1)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbem_3014 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Gbem_3014 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACH40017
JGI: Gbem3014
UniProt: B5E848
Position
complement(3483369..3484448)
Genome map
AA seq 359 aa AA seqDB search
MKIGILTGGGDCPGLNAVIRGVVKSATGRGWEVVGIEDGFDGFLHPEKCRCLGLEEVRGI
LPLGGTILGTSNRGNPFSFPMVREGKVELVDVSDEVCSRIEHLGLSALIVVGGDGSLKIA
QEMMRRGVPIVGVPKTIDNDLLETDVTFGYNTALETATEALDKLHSTAESHHRVMVLEVM
GRYAGWIALESGIAGGADVILIPEIPYDIDKVSEAILARCRRGRRFSVVVVAEGAFPKGG
GRVVKEAAGGKSVVERLGGVGEAFSRELGGVLEMDIRVTVLGHLQRGGSPSTFDRCIGSR
FGVKAVELIESGAFGHMVCLKGRHITSVPIEDAVRSLNLIDPAGEMVRHAEALGIMLGR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagattggaatactcactgggggaggggattgccccgggctgaacgccgtcatcagg
ggggtagtcaaatcggccaccggccgcgggtgggaggtagtcgggatcgaagacggtttc
gacggattcctgcacccggagaaatgccgctgcctcgggctcgaagaggtgcgcggcatc
ctgccgctagggggcaccatactcggcaccagcaacaggggaaacccgttctcctttccc
atggtgcgcgaggggaaggtggaactggtcgacgtctccgacgaagtctgctcccgcatc
gagcacctggggctttccgccttgatcgtagtagggggggacggctcactcaaaatcgcc
caggagatgatgcgccggggcgtccccatcgtcggtgttcccaagaccatcgacaacgac
ctgctggaaaccgacgtcaccttcggctacaacaccgccctcgagaccgccaccgaagcc
ctcgacaagctgcattccactgcggagagccaccaccgggtcatggtgctagaagtcatg
ggacgctatgccggatggatcgcgcttgagtccgggatagccggcggcgccgacgtcatc
ctcatccccgagatcccctacgacatcgacaaggtcagcgaggcgatactcgcgcgctgt
cgccgcggccgccgcttcagcgtcgtcgtggttgccgaaggcgctttccccaagggaggc
gggcgcgtggtcaaggaggccgcgggcggcaagtcggtcgtggaacgtctgggcggagtg
ggcgaggccttctcccgcgagttgggcggggtgcttgagatggacatcagggtaaccgtg
ctcgggcatctgcagcgcggcggttccccctcgaccttcgaccgctgcataggaagccgc
ttcggggtgaaggcggtggagctgatcgaaagcggcgccttcggtcacatggtctgcctc
aagggtcgtcatatcacctcggtgccgatagaggacgcagtgcgcagcctgaacctcatc
gatcccgccggcgagatggtgcgtcacgcggaggcgctcggcatcatgctggggaggtaa

DBGET integrated database retrieval system