KEGG   Geobacter bemidjiensis: Gbem_3014Help
Entry
Gbem_3014         CDS       T00749                                 

Gene name
pfk-1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_3014 (pfk-1)
   01230 Biosynthesis of amino acids
    Gbem_3014 (pfk-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_3014 (pfk-1)
   00030 Pentose phosphate pathway
    Gbem_3014 (pfk-1)
   00051 Fructose and mannose metabolism
    Gbem_3014 (pfk-1)
   00052 Galactose metabolism
    Gbem_3014 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    Gbem_3014 (pfk-1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Gbem_3014 (pfk-1)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbem_3014 (pfk-1)
Protein phosphatases and associated proteins [BR:gbm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gbem_3014 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3483369..3484448)
Genome map
AA seq 359 aa AA seqDB search
MKIGILTGGGDCPGLNAVIRGVVKSATGRGWEVVGIEDGFDGFLHPEKCRCLGLEEVRGI
LPLGGTILGTSNRGNPFSFPMVREGKVELVDVSDEVCSRIEHLGLSALIVVGGDGSLKIA
QEMMRRGVPIVGVPKTIDNDLLETDVTFGYNTALETATEALDKLHSTAESHHRVMVLEVM
GRYAGWIALESGIAGGADVILIPEIPYDIDKVSEAILARCRRGRRFSVVVVAEGAFPKGG
GRVVKEAAGGKSVVERLGGVGEAFSRELGGVLEMDIRVTVLGHLQRGGSPSTFDRCIGSR
FGVKAVELIESGAFGHMVCLKGRHITSVPIEDAVRSLNLIDPAGEMVRHAEALGIMLGR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagattggaatactcactgggggaggggattgccccgggctgaacgccgtcatcagg
ggggtagtcaaatcggccaccggccgcgggtgggaggtagtcgggatcgaagacggtttc
gacggattcctgcacccggagaaatgccgctgcctcgggctcgaagaggtgcgcggcatc
ctgccgctagggggcaccatactcggcaccagcaacaggggaaacccgttctcctttccc
atggtgcgcgaggggaaggtggaactggtcgacgtctccgacgaagtctgctcccgcatc
gagcacctggggctttccgccttgatcgtagtagggggggacggctcactcaaaatcgcc
caggagatgatgcgccggggcgtccccatcgtcggtgttcccaagaccatcgacaacgac
ctgctggaaaccgacgtcaccttcggctacaacaccgccctcgagaccgccaccgaagcc
ctcgacaagctgcattccactgcggagagccaccaccgggtcatggtgctagaagtcatg
ggacgctatgccggatggatcgcgcttgagtccgggatagccggcggcgccgacgtcatc
ctcatccccgagatcccctacgacatcgacaaggtcagcgaggcgatactcgcgcgctgt
cgccgcggccgccgcttcagcgtcgtcgtggttgccgaaggcgctttccccaagggaggc
gggcgcgtggtcaaggaggccgcgggcggcaagtcggtcgtggaacgtctgggcggagtg
ggcgaggccttctcccgcgagttgggcggggtgcttgagatggacatcagggtaaccgtg
ctcgggcatctgcagcgcggcggttccccctcgaccttcgaccgctgcataggaagccgc
ttcggggtgaaggcggtggagctgatcgaaagcggcgccttcggtcacatggtctgcctc
aagggtcgtcatatcacctcggtgccgatagaggacgcagtgcgcagcctgaacctcatc
gatcccgccggcgagatggtgcgtcacgcggaggcgctcggcatcatgctggggaggtaa

DBGET integrated database retrieval system