KEGG   Geobacter bemidjiensis: Gbem_3213Help
Entry
Gbem_3213         CDS       T00749                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00230  Purine metabolism
gbm01100  Metabolic pathways
Module
gbm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Gbem_3213 (gmk)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Gbem_3213 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 Thymidylate_kin AAA_35
Motif
Other DBs
NCBI-ProteinID: ACH40212
JGI: Gbem3213
UniProt: B5E9N8
Position
complement(3702754..3703362)
Genome map
AA seq 202 aa AA seqDB search
MKREGVLYVISAPSGAGKTSLCKEIIDIFPNLRHSVSHTTRPPRTGEVHGRDYFFVGKEE
FNRMVEAGEFAEWAEVHGNLYGTSLATLKESRTDGIDLILDIDCQGARQLKGRFEGGVYI
FVLPPNIEELRRRLDHRSSDSPEVIERRINNAAGEIKEARWYDYIIVNDRFSEAVEQLKS
VLIAERCRTTRLIQGLSATFEI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagaaggcgtactgtatgtgatatcggcaccctcgggggcgggcaagacctcg
ctctgcaaggaaataattgacattttcccgaacctacggcattctgtcagccacacgacg
cgccctccccgtaccggagaggtgcacgggcgtgattatttttttgtgggcaaggaagaa
ttcaaccgcatggtcgaggcgggcgagttcgcggagtgggccgaggttcacggcaacctg
tacggcacctcgcttgccaccttgaaggaatcccgcaccgacgggatcgacctgatcctt
gatatcgactgccagggtgcgcggcagctcaagggacgcttcgaagggggcgtttacatc
ttcgtgctcccaccgaacatcgaggagctgcgccgccgcctcgaccaccgctcctccgac
tccccggaggtgatcgagcgccgcatcaacaacgccgccggcgagatcaaggaagcgcgc
tggtacgactacatcatcgtcaacgaccggttcagcgaggctgtcgagcagctgaagagc
gtgcttatagccgagcgctgcagaaccacccgactcatccagggtctttccgcgaccttc
gagatctaa

DBGET integrated database retrieval system