KEGG   Geobacter bemidjiensis: Gbem_3223Help
Entry
Gbem_3223         CDS       T00749                                 

Gene name
sucC-3
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gbm  Geobacter bemidjiensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_3223 (sucC-3)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbem_3223 (sucC-3)
   00640 Propanoate metabolism
    Gbem_3223 (sucC-3)
   00660 C5-Branched dibasic acid metabolism
    Gbem_3223 (sucC-3)
Enzymes [BR:gbm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gbem_3223 (sucC-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3710417..3711586)
Genome map
AA seq 389 aa AA seqDB search
MNVHEYQAKAILRKFGVPVPDGHVCYNGASAREWAKRLGEGPWVVKAQIHAGGRGKGGGV
KLARTSSEVQMIARDMLGMTLRTHQTGPEGKVVHRVLVECGCNIGSELYVSLLVDRATSR
VTVMASTEGGMDIEEVAAKTPEKIFTEAVDPLVGLTPFQCRKIAFSLGLRGKLTGKAVKV
FTSLYNTFIATDCSLLEINPLVVTAEGELIALDAKFGFDDNALFRHLQIGDMRDFDEEDA
NEIEASQHDLSYISLTGNIGCLVNGAGLAMATMDIIKHYGGDPANFLDVGGGATIERVTE
AFKIILSDKNVKGILVNIFGGIMKCDVIATGVIEAARQVGIQVPLVVRLEGTNVELGKRL
LAESGLNIVAADGMADGAQKIVRAVAAQA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccacgagtaccaggctaaagcaattctgcgcaagttcggggtgccggttccg
gatggccacgtgtgctacaacggtgccagtgccagggaatgggccaagcggctcggcgag
ggaccttgggtggtcaaggcccagatccatgccgggggccgcggcaaggggggaggcgtc
aaattggcgcgcacctcgagcgaggtgcagatgatcgcccgcgacatgctcggcatgacc
ctcaggacgcaccagaccgggccggaagggaaggtggtgcaccgggtcctggtcgagtgc
ggctgcaacatcggcagcgaactgtacgtgagcctcttggtggaccgcgccacttcacgc
gtcacggtcatggcctccaccgagggggggatggacatcgaagaggtggccgcgaagacc
ccggagaagatcttcaccgaggcggtcgatccgctggtggggctgactcccttccagtgc
cgcaagatcgccttcagcttggggctcagggggaagctcacggggaaggccgttaaggtt
ttcacctccctctacaacaccttcatcgctaccgactgttcgctcttggagataaacccc
ttggtcgtcacggccgaaggggaactgatcgcgctggacgcgaaattcggcttcgacgat
aacgcgctcttccgccacctgcagataggcgacatgcgggacttcgacgaggaggacgcg
aacgagatcgaggcatcccagcacgacctctcctacatctcccttaccggcaacatcggc
tgccttgtcaacggcgccggcctcgccatggccaccatggacatcatcaagcactacggc
ggcgacccggcgaacttcctggatgtcgggggcggggccaccatcgagcgcgtcaccgag
gccttcaagatcatcctgtcggataaaaacgtgaaggggatcctggtcaacatcttcggc
gggatcatgaagtgcgacgtcatcgctaccggggtcatcgaagcggcgcggcaggtcggc
atccaggtgcctctcgtggtcaggctggaagggaccaacgtggagttgggcaagcggctt
ctggctgaaagcgggctgaacatagtagctgccgacggcatggccgacggggcgcagaaa
atagtgcgggccgtagcggcccaagcctag

DBGET integrated database retrieval system