KEGG   Geobacter bemidjiensis: Gbem_3234Help
Entry
Gbem_3234         CDS       T00749                                 

Gene name
pfk-4
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:gbm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gbm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gbm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gbm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gbm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:gbm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3725707..3726642)
Genome map
AA seq 311 aa AA seqDB search
MKTIVTITMNPAIDKSATVDHVVAERKLYCSEPLFEPGGGGINVSRAVRKLGGESLALYP
SGGHSGQTLRLLLDQEGLTHRPIEVAGWTRENLIVLESATGQQYRFGMPGPDLSAKEWQA
CLEQIFAGGARPDYLVASGSLPPGVPQDFYARIARLGKQHGARVVVDASGEPMRLALREG
VFLIKPNIREFREMIGEGGEDEARVLALAKKIVLDGQSEVVVISLGAAGVLMVSDSGVER
LHPPTVPIISKVGAGDSMVAGMVLSLARGNTLRDAVRFGVAAGTAAVMTPGTELCRREDA
ERLYRQMLPGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcgtgaccataaccatgaatcctgccatcgataagagtgcgacggtggat
catgtggtggcagaaagaaagctttattgcagcgagccccttttcgagcctgggggaggg
gggatcaacgtctcgcgggcagtgcggaagcttggcggggagtccctggctctttatccg
tcgggagggcacagcggacagacgctgcgcttgctgctcgatcaggaagggcttacgcac
cgtccgattgaggtcgccggctggaccagggagaacctgatcgtgctggagtccgcaacg
gggcagcagtaccgcttcgggatgcctgggccggatctttccgccaaggagtggcaggct
tgcctggaacagatctttgccggcggagcaaggcccgattacctggtggcgagcggcagc
ctccctccgggcgtaccgcaggacttttatgcccggatagcgcgccttggaaagcagcac
ggcgcccgggtggtggtggacgcttcgggcgagcccatgcgcctggcgctgcgcgaggga
gtcttcctgatcaagccgaacatccgggagtttcgcgagatgataggcgaggggggggaa
gacgaagccagggtgctggcgcttgccaagaagattgtcctggatgggcagagcgaggtg
gtggtgatctcgctcggcgcggccggggttctcatggtgtcggactcgggagtggagcgg
ctgcatccccccacggttcccattatcagcaaggtcggcgccggtgactccatggtggcc
ggcatggtattgagccttgcgcgggggaataccctgcgtgacgccgtccgtttcggggtg
gctgccgggaccgccgcggtgatgacgcccggaacggaactctgccgccgggaggatgcc
gagaggctgtaccggcagatgcttccgggcgaatag

DBGET integrated database retrieval system