KEGG   Geobacter bemidjiensis: Gbem_3315Help
Entry
Gbem_3315         CDS       T00749                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gbm  Geobacter bemidjiensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gbm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3811654..3812253
Genome map
AA seq 199 aa AA seqDB search
MIALLTGKLAYKSPEFIILDVNGVGYQVHIPFSTYYTLPVEGGALSLQIHTSVKEDAINL
YGFRTQQEKELFQLLIGVSGVGPKLATGILSNSEPSELADSLVNGNLARLSAIPGIGKKT
AERLVLELKEKMKKLGLAQPQAGGTTAPAKQEIRDDVLSALINLGYKEAVVQKALAELKV
TEDATVELVLKQALKILMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctccttaccggaaagctcgcctacaaatcccccgagttcatcatcctggac
gtcaacggcgtgggataccaggtgcacatccccttctccacctactacaccctccccgtc
gaagggggcgcgctgtcgctgcagatccacacctcggtgaaggaagacgccatcaacctg
tacggcttccgaacccagcaggagaaggaactgttccagctcctgatcggcgtctcaggc
gtggggccgaagctcgccaccggcatactttccaacagcgagccttccgagcttgccgat
tcgctcgtcaacggcaacctggcccggctctccgccattcccggcatcggcaagaaaaca
gcggagcgcctggtgctggaacttaaggaaaagatgaagaagctgggcctcgcgcagccg
caggcaggcggcaccaccgctccggccaaacaggagatcagggacgacgtgctctccgcg
ctcatcaacctggggtacaaggaagccgtggtgcaaaaggcactggcagagttgaaggtc
acggaagacgcgaccgtcgaactcgtgctcaagcaggcgctgaagatactgatgaagtag

DBGET integrated database retrieval system