KEGG   Geobacter bemidjiensis: Gbem_3350Help
Entry
Gbem_3350         CDS       T00749                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00260  Glycine, serine and threonine metabolism
gbm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01130  Biosynthesis of antibiotics
gbm01230  Biosynthesis of amino acids
Module
gbm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_3350 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbem_3350 (trpA)
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gbem_3350 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ACH40345
JGI: Gbem3350
UniProt: B5EAK6
Position
complement(3848588..3849391)
Genome map
AA seq 267 aa AA seqDB search
MSRISDRFASLKERGEKALVTFVTAGDPDLATTEKVVLELERAGADLIELGVPFSDPMAD
GPTIQLSSDRALASGTTLPAILELVSRLREKTQVPIVLMGYFNPIFAYGSERFAFDAAQA
GVDALLVVDLPPEEAAELKGATDSCGLDLIFLLTPTSDGSRIASVARQGSGFIYYVSVTG
VTGARSAVADDLAARVTEVRGALELPLVVGFGISTPEQAGEVARAADGVVVGSALVKYFE
KYQGAELLEQLGGFVSALKQGVLKGSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatttcagatagatttgccagcctgaaagaacgtggggaaaaggcgctggtc
accttcgtcaccgccggcgacccggatctggcgactacggaaaaggtggtgctcgaactc
gaacgggcaggggccgacctgatcgagctgggagttcccttctccgatcccatggctgac
ggcccgaccatccagctctcctcggaccgggccctggcctccggcaccactctcccggca
atactggagctggtatcgaggctcagggaaaagacccaggtccccatcgtgctgatgggt
tacttcaaccccatcttcgcctacggttccgagcgctttgccttcgacgcggcacaagcc
ggcgtcgacgccctgctggtggtggatctcccccccgaggaggctgcggagctaaaagga
gctaccgacagctgcggactcgacctcatcttcctcctcaccccgacctcagacggctcc
cggatcgcttctgtcgcgcgccagggaagcggcttcatctactacgtctccgtcaccggc
gtcaccggcgcgcgtagcgcggtcgccgatgacctggcggcccgggtcaccgaggtgcgc
ggcgcgctggaactgccgcttgtggtcggcttcggcatctccaccccggagcaggcgggg
gaggtggcccgggcggccgacggcgtggtggtgggaagcgcgctggtgaagtacttcgag
aagtaccagggggccgaactcctggaacagctggggggattcgtctcggcgctaaaacaa
ggagtgctgaagggctcccggtaa

DBGET integrated database retrieval system