KEGG   Geobacter bemidjiensis: Gbem_3350Help
Entry
Gbem_3350         CDS       T00749                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbem_3350 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_3350 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbem_3350 (trpA)
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gbem_3350 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3848588..3849391)
Genome map
AA seq 267 aa AA seqDB search
MSRISDRFASLKERGEKALVTFVTAGDPDLATTEKVVLELERAGADLIELGVPFSDPMAD
GPTIQLSSDRALASGTTLPAILELVSRLREKTQVPIVLMGYFNPIFAYGSERFAFDAAQA
GVDALLVVDLPPEEAAELKGATDSCGLDLIFLLTPTSDGSRIASVARQGSGFIYYVSVTG
VTGARSAVADDLAARVTEVRGALELPLVVGFGISTPEQAGEVARAADGVVVGSALVKYFE
KYQGAELLEQLGGFVSALKQGVLKGSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatttcagatagatttgccagcctgaaagaacgtggggaaaaggcgctggtc
accttcgtcaccgccggcgacccggatctggcgactacggaaaaggtggtgctcgaactc
gaacgggcaggggccgacctgatcgagctgggagttcccttctccgatcccatggctgac
ggcccgaccatccagctctcctcggaccgggccctggcctccggcaccactctcccggca
atactggagctggtatcgaggctcagggaaaagacccaggtccccatcgtgctgatgggt
tacttcaaccccatcttcgcctacggttccgagcgctttgccttcgacgcggcacaagcc
ggcgtcgacgccctgctggtggtggatctcccccccgaggaggctgcggagctaaaagga
gctaccgacagctgcggactcgacctcatcttcctcctcaccccgacctcagacggctcc
cggatcgcttctgtcgcgcgccagggaagcggcttcatctactacgtctccgtcaccggc
gtcaccggcgcgcgtagcgcggtcgccgatgacctggcggcccgggtcaccgaggtgcgc
ggcgcgctggaactgccgcttgtggtcggcttcggcatctccaccccggagcaggcgggg
gaggtggcccgggcggccgacggcgtggtggtgggaagcgcgctggtgaagtacttcgag
aagtaccagggggccgaactcctggaacagctggggggattcgtctcggcgctaaaacaa
ggagtgctgaagggctcccggtaa

DBGET integrated database retrieval system