KEGG   Geobacter bemidjiensis: Gbem_3361Help
Entry
Gbem_3361         CDS       T00749                                 

Gene name
hpnA
Definition
NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Gbem_3361 (hpnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3863541..3864530
Genome map
AA seq 329 aa AA seqDB search
MKAFVTGATGFIGASIVRELLKDGWEVRVLARPGSDRRNLFGLDVEIREGDLSDREALVQ
ALSGCQALFHAAADYRLWTRTPQAMYDVNVKGTRAILSAALAAGIEKVVYTSSVGTLGTP
GDGTPGDEGTPVDFCHMVGDYKKSKFLAERAAESFLEKGLPLVIVNPSTPVGPMDVKPTP
TGKIIVDFLNGRMPAYLDTGLNLIDVEACARGHILAAQKGRVGEKYILGNRNLTLAEIFE
ILSGITGLKAPRVKLPYYPILMAAYANHALSAVTGKEPLIPLAGVQMAAKFMYFDSGKAV
SELGLPLCPVEGALERAVEWFRSNGYVNR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattcgtcacaggcgccaccgggttcatcggcgcgagcatcgtgcgcgaattg
ttgaaggacggctgggaggtacgggtgctggcccggcccggctcggaccgccgcaacctc
ttcgggctcgacgtggagatccgggaaggggatctgagcgatcgcgaagcgctggtgcag
gcgctcagcggctgtcaggcgctgttccacgccgccgccgactaccggctctggacacgc
acgccgcaggccatgtacgatgtcaacgtcaaagggacccgggccatactgtcggcggct
ctcgcggcggggatcgagaaggtggtctacaccagcagcgtcgggaccctgggcaccccc
ggcgacggcacccccggcgacgagggcaccccggtggatttttgccacatggtgggggac
tacaaaaagagcaagttcctcgccgagcgggccgcggaatcgtttctggagaaggggttg
ccgctcgtgatcgtgaacccatcgaccccggtggggccgatggatgtgaagcctacgcct
acgggaaagatcatagtcgacttcctgaacggccggatgcccgcctacctggacaccggg
ctgaacctgatagacgtagaggcgtgcgcccggggtcatatcctggcggcgcagaagggg
cgagtcggggaaaagtacatccttggcaaccgcaacctgaccctggccgagatattcgag
attctctccggcatcaccggtctcaaggcgccgcgggtgaagctcccctactatccgata
ctcatggccgcctatgcgaaccatgcactgtcggccgtgaccgggaaagagccgctgata
ccgcttgccggagtgcagatggcagcgaagttcatgtatttcgattcggggaaggcggtg
agcgagttggggttgccgctttgtcccgtggaaggcgcgctggagcgagccgtagaatgg
ttccgcagcaacggctacgtaaaccggtga

DBGET integrated database retrieval system