KEGG   Geobacter bemidjiensis: Gbem_3501Help
Entry
Gbem_3501         CDS       T00749                                 

Gene name
gpmA
Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbem_3501 (gpmA)
   01230 Biosynthesis of amino acids
    Gbem_3501 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_3501 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Gbem_3501 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_3501 (gpmA)
Enzymes [BR:gbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Gbem_3501 (gpmA)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Gbem_3501 (gpmA)
  Exosomal proteins of melanoma cells
   Gbem_3501 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4011796..4012500
Genome map
AA seq 234 aa AA seqDB search
MHQLVLLRHGESVWNKENLFTGWTDVELSPRGEEESRNAGLLLKEHGFVFDLAFTSLLKR
AIKTLWIVLEQMDLMWIPEHKEWRLNERHYGALQGLNKAQTAQEYGDEQVKLWRRSYKVR
PPALAEGDQRHPSFDPRYHSLSRDLLPDTECLQDTVERVLPFWQQQAVPALQQGKRILIA
AHGNSLRGLIKYLDQIPDDDIVGLEIPTGSPLVYELDRDLKPVRRYYLETGKAG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactggtgctgctgcgacatggcgaaagcgtctggaacaaggagaacctcttc
acggggtggaccgacgtggagctctccccgcggggggaggaggagagccgcaacgcgggg
ctgctcctgaaggagcacggcttcgtcttcgacctggcctttacctccctcttgaagcgg
gcgataaagacgctctggatcgtgctggagcagatggacctgatgtggattccggagcac
aaggagtggcgcctgaacgagaggcattacggcgcgctgcaggggctgaacaaggcgcag
accgcgcaagagtacggggacgagcaggtgaaactctggaggcgcagctataaggtgcgg
ccgccggcgctcgcggagggagaccagcggcacccgtcgttcgacccgcgctaccactcc
ctctccagggatctgctccccgataccgagtgcctgcaggacacggtcgagcgcgtgctt
cccttctggcagcagcaggcggtcccggccctgcagcaaggaaagcgcatcctgatcgcg
gcgcacggcaacagcctgcgggggctgatcaagtacctggaccagatcccggacgacgac
atcgtggggctggagatccccaccgggagcccgctggtgtacgaactggaccgcgacctg
aagcccgtgcgccgctactacctggagacggggaaagccgggtaa

DBGET integrated database retrieval system