KEGG   Geobacter bemidjiensis: Gbem_3501Help
Entry
Gbem_3501         CDS       T00749                                 

Gene name
gpmA
Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:gbm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gbm00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:gbm00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gbm00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4011796..4012500
Genome map
AA seq 234 aa AA seqDB search
MHQLVLLRHGESVWNKENLFTGWTDVELSPRGEEESRNAGLLLKEHGFVFDLAFTSLLKR
AIKTLWIVLEQMDLMWIPEHKEWRLNERHYGALQGLNKAQTAQEYGDEQVKLWRRSYKVR
PPALAEGDQRHPSFDPRYHSLSRDLLPDTECLQDTVERVLPFWQQQAVPALQQGKRILIA
AHGNSLRGLIKYLDQIPDDDIVGLEIPTGSPLVYELDRDLKPVRRYYLETGKAG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactggtgctgctgcgacatggcgaaagcgtctggaacaaggagaacctcttc
acggggtggaccgacgtggagctctccccgcggggggaggaggagagccgcaacgcgggg
ctgctcctgaaggagcacggcttcgtcttcgacctggcctttacctccctcttgaagcgg
gcgataaagacgctctggatcgtgctggagcagatggacctgatgtggattccggagcac
aaggagtggcgcctgaacgagaggcattacggcgcgctgcaggggctgaacaaggcgcag
accgcgcaagagtacggggacgagcaggtgaaactctggaggcgcagctataaggtgcgg
ccgccggcgctcgcggagggagaccagcggcacccgtcgttcgacccgcgctaccactcc
ctctccagggatctgctccccgataccgagtgcctgcaggacacggtcgagcgcgtgctt
cccttctggcagcagcaggcggtcccggccctgcagcaaggaaagcgcatcctgatcgcg
gcgcacggcaacagcctgcgggggctgatcaagtacctggaccagatcccggacgacgac
atcgtggggctggagatccccaccgggagcccgctggtgtacgaactggaccgcgacctg
aagcccgtgcgccgctactacctggagacggggaaagccgggtaa

DBGET integrated database retrieval system