KEGG   Geobacter bemidjiensis: Gbem_3501Help
Entry
Gbem_3501         CDS       T00749                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00260  Glycine, serine and threonine metabolism
gbm00680  Methane metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01230  Biosynthesis of amino acids
Module
gbm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_3501 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Gbem_3501 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbem_3501 (gpmA)
Enzymes [BR:gbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Gbem_3501 (gpmA)
Membrane trafficking [BR:gbm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Gbem_3501 (gpmA)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Gbem_3501 (gpmA)
  Exosomal proteins of melanoma cells
   Gbem_3501 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACH40494
JGI: Gbem3501
UniProt: B5EC38
Position
4011796..4012500
Genome map
AA seq 234 aa AA seqDB search
MHQLVLLRHGESVWNKENLFTGWTDVELSPRGEEESRNAGLLLKEHGFVFDLAFTSLLKR
AIKTLWIVLEQMDLMWIPEHKEWRLNERHYGALQGLNKAQTAQEYGDEQVKLWRRSYKVR
PPALAEGDQRHPSFDPRYHSLSRDLLPDTECLQDTVERVLPFWQQQAVPALQQGKRILIA
AHGNSLRGLIKYLDQIPDDDIVGLEIPTGSPLVYELDRDLKPVRRYYLETGKAG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactggtgctgctgcgacatggcgaaagcgtctggaacaaggagaacctcttc
acggggtggaccgacgtggagctctccccgcggggggaggaggagagccgcaacgcgggg
ctgctcctgaaggagcacggcttcgtcttcgacctggcctttacctccctcttgaagcgg
gcgataaagacgctctggatcgtgctggagcagatggacctgatgtggattccggagcac
aaggagtggcgcctgaacgagaggcattacggcgcgctgcaggggctgaacaaggcgcag
accgcgcaagagtacggggacgagcaggtgaaactctggaggcgcagctataaggtgcgg
ccgccggcgctcgcggagggagaccagcggcacccgtcgttcgacccgcgctaccactcc
ctctccagggatctgctccccgataccgagtgcctgcaggacacggtcgagcgcgtgctt
cccttctggcagcagcaggcggtcccggccctgcagcaaggaaagcgcatcctgatcgcg
gcgcacggcaacagcctgcgggggctgatcaagtacctggaccagatcccggacgacgac
atcgtggggctggagatccccaccgggagcccgctggtgtacgaactggaccgcgacctg
aagcccgtgcgccgctactacctggagacggggaaagccgggtaa

DBGET integrated database retrieval system