KEGG   Geobacter bemidjiensis: Gbem_3767Help
Entry
Gbem_3767         CDS       T00749                                 

Gene name
flhA
Definition
flagellar biosynthesis protein FlhA
Orthology
K02400  
flagellar biosynthesis protein FlhA
Organism
gbm  Geobacter bemidjiensis
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:gbm02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4302233..4304311)
Genome map
AA seq 692 aa AA seqDB search
MANGATDALALPGPKKNSDIYMAVALIGILSLMIIPVPAFMLDVFLAANITIALVILLVC
LYTIQPLDFSVFPSILLVTTLFRLALNIASTRLILLHGSEGVEAAGGVIKAFGQFVVGGN
YVVGAVIFLILVIINFVVITKGAGRVAEVAARFTLDAMPGKQMAIDADLSNGLLTDKEAK
ERRKKIAREADFYGSMDGASKFVRGDAVAGIMIVLVNIIGGFIIGVWQKGMALDQALTNY
TLLTIGEGLVAQVPALIISTAAGVIVTRSADENNFGHEIAGQLLNYPKAFQVASGVLFVF
ALIPGLPHFAFFLLSGVAYLVSKMAVEKKAEIEDVVETQAGAEDLDQISSIRPLDMLELE
VGYGLVPMVDASQQGELLDRIRSIRKQVADRMGFIVPPIHIHDNLQLKPYEYNLLINGAK
VGGGELAGQYLAMDSGGATGQLEGIKTTEPVFGLPAVWIKGKERERAQVSGYTVVDNTTI
LATHISETIKKHAHELVGRQELQQLLDSIAATLPKVVEELVPSLLSLGTVLRVVKNLLKE
NVSIRDLRSILETLADFGGVTKDPDMLTEFVRQSLGRYIVEQYKREDDTLCVLTMDREVE
ETIADAVQLSEQGSYLAIEPGVAQRILAAIRRNAEQFDATGVLPVLMASPSIRRHVKKLT
ERYMPNLAVISHNEIPPNIKIQSLGVVVLNAS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacggcgcgaccgacgccctggcgctaccaggacccaagaaaaattcggatatc
tacatggcggtggccctgatcgggatactgtccctgatgatcatcccggtaccggcattc
atgctggacgtcttcctcgcggccaacatcaccatcgctctcgtcatcctgctggtctgc
ctctacacgatccaaccgctcgacttctctgtgtttccgtccatcctgctggtcaccacg
ctcttccggttggccctgaacatcgcctccacccggctcatccttttgcacggcagcgaa
ggggtcgaggcggcgggcggcgtcatcaaggccttcgggcagttcgtggtcggcggcaac
tacgtggtcggcgccgtcatcttcctgatcctcgtcatcatcaacttcgtggtcatcacc
aagggcgccgggcgcgtcgccgaggtcgccgccaggttcaccctggacgccatgcccggc
aagcagatggccatcgacgccgacctctccaacggccttctgaccgacaaggaggcgaag
gagcggcgcaagaagatcgcgcgcgaggcggacttctacggctccatggacggtgccagc
aagttcgtgcgcggggacgccgtcgccggcatcatgatcgtcctcgtcaacatcatcggc
ggcttcatcatcggcgtctggcaaaaggggatggcgctggaccaggcgctcaccaactac
acgctcctcaccatcggcgaggggctcgtggcccaggtcccggcgctgatcatctccacc
gcggccggcgtcatcgttacccgctcggccgacgagaacaacttcggccacgagatcgca
ggacagctcctcaactacccgaaggcgttccaggtggcctccggtgttcttttcgtcttc
gccctgatcccggggctgccgcatttcgccttcttcctcctctccggcgtcgcctacctg
gtgagcaagatggcggtggagaagaaggcggagatcgaggatgtcgtagagacccaggcg
ggggcggaggatctggaccagatcagctccatcaggcctttggacatgctggaactggag
gtaggctacggcctggtccccatggtggacgcaagccagcagggggagcttttggaccgg
atccgctccatcaggaagcaggtggcggaccgcatggggttcatcgttccccccatccat
atccacgacaacctgcagctgaagccgtacgagtacaacctcctgatcaacggcgccaag
gtgggagggggggagctcgccggccagtacctcgccatggactccggcggcgctaccggc
cagctcgaggggatcaagaccaccgagccggtattcgggcttcccgccgtgtggatcaag
gggaaagagcgggagagggcgcaggtctccggctacacggtcgtggacaacaccaccatc
ctcgccacccacatcagcgagaccatcaagaagcacgcccacgaactggtggggcgccag
gagctgcagcagcttctggacagcatcgccgccacgctcccgaaggtggtggaggaactg
gtgccgtcgctcctctccctgggaacggtgctgcgcgtggtcaagaaccttttgaaggaa
aacgtctccatcagggacctgcgctccatcctggagacgctggccgacttcggcggcgtg
accaaggacccggacatgctcaccgagttcgtgcgccagagcctgggacgctacatagtg
gagcagtacaagcgggaggacgacacgctctgcgtcctcaccatggaccgcgaggtggag
gagaccatagccgacgcggtgcagctttcggagcaggggagctacctggccatcgagccg
ggggtggcgcagcgcatcctggccgccatccggagaaacgccgagcagttcgacgccacc
ggcgtcctgccggtcctgatggcgtcccccagcatacggcgccacgtgaagaagcttacc
gaacgttacatgcccaacctggcggtcatctcgcacaacgagatcccgccgaatataaaa
atccaatctttaggcgtggtggtgctcaatgctagttaa

DBGET integrated database retrieval system