KEGG   Gordonia bronchialis: Gbro_0293Help
Entry
Gbro_0293         CDS       T01102                                 

Definition
dienelactone hydrolase
Orthology
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
gbr  Gordonia bronchialis
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:gbr00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:gbr00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:gbr00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325080..325817
Genome map
AA seq 245 aa AA seqDB search
MTSSVTVERITIDAEPDSFDALIARPAEPSGPRPSVLLVHDATGDEVDTERNLRIVAGQG
YLALAPLLFTTGPNKLGCIVSAMRSLAVGHGPAFAILERARVTLADDAQSTGDVAIVGFC
MGGGFALLEGDARYVAAAPFYGSLTSYRRVRADTCPVVASFGQRDPLLPFGERRLRRVLD
KHGITSDIKTYPGVGHSFANQIDAVPDRVLRIAGMHYDADVSADAWGRVFAFFAARFAEH
DEHRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgtccgtgactgtcgaacgcatcaccatcgacgccgaacccgactccttcgac
gctctcatcgcccgccccgccgagccgagcggcccacgtccctcggttctgctcgtgcat
gatgcgaccggcgacgaagtcgacaccgaacggaatctgcggatcgtcgccggccaggga
tacctcgcgttggcgccgctgctgttcaccaccggcccgaacaagctgggctgcatcgtt
tccgcgatgcgatcactcgctgtgggccacgggccggccttcgcgattctggagcgcgcc
cgcgtgaccctcgccgacgacgcgcaatccaccggcgatgtcgccattgtcggtttctgc
atgggtggcggcttcgccctactcgagggtgatgcgcgctatgtggccgcagccccgttc
tacggcagcctcaccagctatcgccgggtccgcgccgatacctgcccggtcgtcgcttca
ttcggtcagcgtgatccgctgcttccgttcggtgagcgacggctacgtcgggttctcgac
aagcacgggatcacctccgacatcaagacctatcccggtgtcggacacagctttgccaac
cagatcgacgccgtgcccgaccgcgtgttacgcatcgccggcatgcactacgacgcggac
gtgtccgccgacgcctggggccgtgtattcgctttcttcgcagcacgtttcgccgagcac
gacgaacatagggcttaa

DBGET integrated database retrieval system