KEGG   Gordonia bronchialis: Gbro_0293Help
Entry
Gbro_0293         CDS       T01102                                 

Definition
dienelactone hydrolase
Orthology
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
gbr  Gordonia bronchialis
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Gbro_0293
   00361 Chlorocyclohexane and chlorobenzene degradation
    Gbro_0293
   00623 Toluene degradation
    Gbro_0293
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Gbro_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325080..325817
Genome map
AA seq 245 aa AA seqDB search
MTSSVTVERITIDAEPDSFDALIARPAEPSGPRPSVLLVHDATGDEVDTERNLRIVAGQG
YLALAPLLFTTGPNKLGCIVSAMRSLAVGHGPAFAILERARVTLADDAQSTGDVAIVGFC
MGGGFALLEGDARYVAAAPFYGSLTSYRRVRADTCPVVASFGQRDPLLPFGERRLRRVLD
KHGITSDIKTYPGVGHSFANQIDAVPDRVLRIAGMHYDADVSADAWGRVFAFFAARFAEH
DEHRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgtccgtgactgtcgaacgcatcaccatcgacgccgaacccgactccttcgac
gctctcatcgcccgccccgccgagccgagcggcccacgtccctcggttctgctcgtgcat
gatgcgaccggcgacgaagtcgacaccgaacggaatctgcggatcgtcgccggccaggga
tacctcgcgttggcgccgctgctgttcaccaccggcccgaacaagctgggctgcatcgtt
tccgcgatgcgatcactcgctgtgggccacgggccggccttcgcgattctggagcgcgcc
cgcgtgaccctcgccgacgacgcgcaatccaccggcgatgtcgccattgtcggtttctgc
atgggtggcggcttcgccctactcgagggtgatgcgcgctatgtggccgcagccccgttc
tacggcagcctcaccagctatcgccgggtccgcgccgatacctgcccggtcgtcgcttca
ttcggtcagcgtgatccgctgcttccgttcggtgagcgacggctacgtcgggttctcgac
aagcacgggatcacctccgacatcaagacctatcccggtgtcggacacagctttgccaac
cagatcgacgccgtgcccgaccgcgtgttacgcatcgccggcatgcactacgacgcggac
gtgtccgccgacgcctggggccgtgtattcgctttcttcgcagcacgtttcgccgagcac
gacgaacatagggcttaa

DBGET integrated database retrieval system