KEGG   Gordonia bronchialis: Gbro_0293Help
Entry
Gbro_0293         CDS       T01102                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00361  Chlorocyclohexane and chlorobenzene degradation
gbr00364  Fluorobenzoate degradation
gbr00623  Toluene degradation
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Gbro_0293
   00361 Chlorocyclohexane and chlorobenzene degradation
    Gbro_0293
   00623 Toluene degradation
    Gbro_0293
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Gbro_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DLH Abhydrolase_2 Peptidase_S9 Chlorophyllase Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACY19635
UniProt: D0LCB1
Position
325080..325817
Genome map
AA seq 245 aa AA seqDB search
MTSSVTVERITIDAEPDSFDALIARPAEPSGPRPSVLLVHDATGDEVDTERNLRIVAGQG
YLALAPLLFTTGPNKLGCIVSAMRSLAVGHGPAFAILERARVTLADDAQSTGDVAIVGFC
MGGGFALLEGDARYVAAAPFYGSLTSYRRVRADTCPVVASFGQRDPLLPFGERRLRRVLD
KHGITSDIKTYPGVGHSFANQIDAVPDRVLRIAGMHYDADVSADAWGRVFAFFAARFAEH
DEHRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgtccgtgactgtcgaacgcatcaccatcgacgccgaacccgactccttcgac
gctctcatcgcccgccccgccgagccgagcggcccacgtccctcggttctgctcgtgcat
gatgcgaccggcgacgaagtcgacaccgaacggaatctgcggatcgtcgccggccaggga
tacctcgcgttggcgccgctgctgttcaccaccggcccgaacaagctgggctgcatcgtt
tccgcgatgcgatcactcgctgtgggccacgggccggccttcgcgattctggagcgcgcc
cgcgtgaccctcgccgacgacgcgcaatccaccggcgatgtcgccattgtcggtttctgc
atgggtggcggcttcgccctactcgagggtgatgcgcgctatgtggccgcagccccgttc
tacggcagcctcaccagctatcgccgggtccgcgccgatacctgcccggtcgtcgcttca
ttcggtcagcgtgatccgctgcttccgttcggtgagcgacggctacgtcgggttctcgac
aagcacgggatcacctccgacatcaagacctatcccggtgtcggacacagctttgccaac
cagatcgacgccgtgcccgaccgcgtgttacgcatcgccggcatgcactacgacgcggac
gtgtccgccgacgcctggggccgtgtattcgctttcttcgcagcacgtttcgccgagcac
gacgaacatagggcttaa

DBGET integrated database retrieval system