KEGG   Gordonia bronchialis: Gbro_0293Help
Entry
Gbro_0293         CDS       T01102                                 

Definition
dienelactone hydrolase
Orthology
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
gbr  Gordonia bronchialis
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Gbro_0293
   00361 Chlorocyclohexane and chlorobenzene degradation
    Gbro_0293
   00623 Toluene degradation
    Gbro_0293
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Gbro_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325080..325817
Genome map
AA seq 245 aa AA seqDB search
MTSSVTVERITIDAEPDSFDALIARPAEPSGPRPSVLLVHDATGDEVDTERNLRIVAGQG
YLALAPLLFTTGPNKLGCIVSAMRSLAVGHGPAFAILERARVTLADDAQSTGDVAIVGFC
MGGGFALLEGDARYVAAAPFYGSLTSYRRVRADTCPVVASFGQRDPLLPFGERRLRRVLD
KHGITSDIKTYPGVGHSFANQIDAVPDRVLRIAGMHYDADVSADAWGRVFAFFAARFAEH
DEHRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgtccgtgactgtcgaacgcatcaccatcgacgccgaacccgactccttcgac
gctctcatcgcccgccccgccgagccgagcggcccacgtccctcggttctgctcgtgcat
gatgcgaccggcgacgaagtcgacaccgaacggaatctgcggatcgtcgccggccaggga
tacctcgcgttggcgccgctgctgttcaccaccggcccgaacaagctgggctgcatcgtt
tccgcgatgcgatcactcgctgtgggccacgggccggccttcgcgattctggagcgcgcc
cgcgtgaccctcgccgacgacgcgcaatccaccggcgatgtcgccattgtcggtttctgc
atgggtggcggcttcgccctactcgagggtgatgcgcgctatgtggccgcagccccgttc
tacggcagcctcaccagctatcgccgggtccgcgccgatacctgcccggtcgtcgcttca
ttcggtcagcgtgatccgctgcttccgttcggtgagcgacggctacgtcgggttctcgac
aagcacgggatcacctccgacatcaagacctatcccggtgtcggacacagctttgccaac
cagatcgacgccgtgcccgaccgcgtgttacgcatcgccggcatgcactacgacgcggac
gtgtccgccgacgcctggggccgtgtattcgctttcttcgcagcacgtttcgccgagcac
gacgaacatagggcttaa

DBGET integrated database retrieval system